KEGG   Citrobacter koseri: CKO_01011Help
Entry
CKO_01011         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cko  Citrobacter koseri
Pathway
cko00500  Starch and sucrose metabolism
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKO_01011
Enzymes [BR:cko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CKO_01011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: ABV12157
UniProt: A8AF94
LinkDB All DBs
Position
complement(999496..1000983)
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQYFHWYYPDGGKLWPELAERAGGLNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLAAIEALKQNDIAVLLDVVVNHKMGADEKEAIRVQRV
NEDNRTQIDDEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGDGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMAQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQAYIDQVDGKTMLFDAPLQMNFHEAS
RQGRDYDMSQIFTDTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGGDGETYTIDMPVIGQLDQLILARQRFAHGIQTLFFDHPNCV
AFSRSGTDDDPGCVVVLSNGDDGEKTITLGENYANKTWRDFLGNREERVTTDEKGEATFT
CNGGCVSVWVIEDVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgctattgcagtacttccactggtattaccctgacggcggcaagctc
tggccagaactggctgagcgcgctggcggcctcaatgatatcggcattaatatggtctgg
ttaccgcccgcctataaaggcgcgtccggcgggtattccgtaggttatgactcgtatgac
ctgtttgatctgggtgagtttgatcagaaaggatctgtcgccacaaaatatggcgacaaa
gcgcagctgctggccgccattgaggcgctaaagcaaaatgacattgcggttttgctcgac
gtggtcgtcaaccacaaaatgggcgcggatgaaaaagaggccattcgcgtacagcgggtc
aatgaagataatcgcacgcaaatcgatgacgagatcatcgaatgtgaaggctggacgcgt
tacaccttccctgcccgcgccggtcaatattcgcagtttatctgggatttcaaatgcttc
agcggtattgatcacatcgaaaacccggacgaagacggcatctttaagatcgtcaacgac
tacactggcgacggctggaacgaccaggtcgatgatgagatgggtaatttcgactatctg
atgggcgaaaacatcgactttcgcaaccatgcggtcaccgaggagatcaaatactgggca
cgttgggtaatggcgcaaacccattgtgacggcttccgcctggatgcggtcaaacacatt
ccggcctggttttataaagagtggatagaacacgtccaggaggtagcgccaaagccgctg
ttcattgtggcggagtactggtctcatgaagtggacaagctacaagcctatatcgatcag
gtggatggaaaaaccatgctgttcgacgcgccgctacagatgaacttccacgaagcctct
cgtcaggggcgtgattacgatatgagccagattttcaccgacacgctggtggaagccgat
cctttccatgccgtaacgctcgtggcaaatcacgacacccaaccgttacaggcgcttgaa
gcgcccgttgaagcctggtttaagccgctggcctatgcgttgatcctgttgcgggagaac
ggcgtaccgtcagtgttctaccctgatctctacggcgcacattacgaagatacgggtggc
gacggcgaaacctacaccattgatatgcccgttattgggcagctcgatcaactgattctc
gcgcgccagcgttttgcccacggcatccagacgctctttttcgaccaccccaactgcgtt
gcctttagccgtagcggtacagacgacgatcctggctgcgtggtcgtactttccaacggc
gatgacggcgagaagaccattacgctaggtgaaaattacgccaacaagacctggcgtgat
tttttaggcaatcgggaagagcgcgtaaccaccgatgaaaagggggaggccacgtttacc
tgcaacggcggctgcgtcagcgtatgggtcattgaagatgtgctgtaa

DBGET integrated database retrieval system