KEGG   Citrobacter koseri: CKO_01514Help
Entry
CKO_01514         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
cko  Citrobacter koseri
Pathway
cko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CKO_01514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4 Fer4_17 Fer4_21 Fer4_16 Fer4_4 Fer4_3 GP120 APC_u14 Fer4_20 Fer4_8 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABV12646
UniProt: A8AGN3
LinkDB All DBs
Position
1467739..1468623
Genome map
AA seq 294 aa AA seqDB search
MSLETQDIIKRSATNPITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNVPRLNKEDNRVYKCTLCVDRVSIGQEPACVKTCP
TGAIHFGTKKEMLEMGEQRVEKLKARGFEHAGVYNPQGVGGTHVMYVLHHANQPELYHGL
PKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKEVDDEEEDHHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggaaacgcaggacatcatcaaacggtctgcaacaaacccgatcacgccgcct
ccccaggcgcgtgattataaagcggaagtcgcaaaactgatcgacgtctcctcctgcgta
ggctgtaaagcctgccaggtggcttgttccgagtggaatgacattcgtgacgaggtaggt
cattgcgtcggggtgtatgacaacccggccgatctcagcgcgaaatcctggacggtaatg
cgttttagcgaaactgaacagaacggcaagctggaatggctgattcgtaaagacggctgt
atgcactgtgaagatccgggctgcctgaaagcatgcccgtctgccggcgcgatcattcag
tacgctaacgggattgttgatttccagtccgaacattgtattggctgtggctactgcatc
gccgggtgtccatttaatgttccgcgcctcaataaagaggacaaccgcgtctataaatgt
acgctgtgtgtggatcgcgtcagtatcggtcaggaaccggcttgcgtgaaaacttgcccg
accggggcaatccatttcggcaccaagaaagagatgctggagatgggggagcagcgcgtg
gagaaactcaaagcgcgcggtttcgaacatgccggtgtttacaacccacaaggtgtgggc
ggtacgcacgtcatgtacgttctgcatcacgcgaaccagccggagctgtatcacggctta
ccgaaagatccacagatcgatacctctatcaacttgtggaaaggggcgctgaaacctctg
gctgccgccgggtttatcgccaccttcgccgggcttatctatcactacattggtattggc
ccgaacaaggaagtggacgatgaagaggaggaccatcatgagtaa

DBGET integrated database retrieval system