KEGG   Citrobacter koseri: CKO_02788Help
Entry
CKO_02788         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cko  Citrobacter koseri
Pathway
cko00730  Thiamine metabolism
cko00790  Folate biosynthesis
cko01100  Metabolic pathways
cko02020  Two-component system
Module
cko_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CKO_02788
   00790 Folate biosynthesis
    CKO_02788
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CKO_02788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cko04147]
    CKO_02788
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cko00537]
    CKO_02788
Enzymes [BR:cko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CKO_02788
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKO_02788
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cko00537]
 Enzymes
  CKO_02788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: ABV13894
UniProt: A8AK81
LinkDB All DBs
Position
complement(2583822..2585237)
Genome map
AA seq 471 aa AA seqDB search
MKQSAIAIALLPLLFTPITHARTSTMTVLDNRAAQGDITTPGGARRLAGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAQGAGGFFKGIDALPLTGQYTHYALDKETGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHTTILEMAKAAGLATGNVSTAELQDATPAA
LVSHVTSRKCYGPNLTSTLCPTNALEKGGKGSITEQLLNTRADVTLGGGAATFAEMATAG
EWQGKTLREQALARGYQLVNDADSLKAVTAANQDKPLLGLFSDGNMPVRWEGPKASYHGN
LEQPAVTCKANPQRDDTVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKKEGNTLVVVTADHAHSSQIIAPESKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgctattgctattgccctgttacctctgctgtttacccccattacgcat
gccaggacgtccacgatgacggtgctggataatcgtgccgcacagggagatattaccacg
ccgggcggggcgcgccgattagcgggcgatcaaacggcggcgctgcgagattcgctgagc
gataaaccggccaaaaatattatcctgctgattggcgacggtatgggtgattctgaaatc
actgcggcgcgaaattatgcgcaaggggccggcggcttttttaaaggaattgatgcttta
ccgttgaccgggcaatacacccattacgcgctggataaagaaacgggtaaaccggattac
gtcacagactccgccgcgtcggcaacggcgtggtcgacgggagttaaaacctataacggc
gcgttaggcgtcgatatccacgaaaaagatcacaccacgatcctggagatggccaaagcg
gcaggtctggcgacgggcaacgtctcgaccgcagaattacaggatgcgacacccgccgcg
ttagtctcccatgtaacctcacgcaaatgctacggccccaaccttaccagcactctttgc
ccgacaaacgcgctggagaagggtggaaaagggtcgatcaccgagcaactgctgaatacg
cgggcggacgttacgcttggtggcggcgcggccacctttgctgaaatggcgacagcaggc
gaatggcaggggaaaacgctgcgtgagcaggcgctggcgcggggatatcagctggtgaac
gatgccgactcgctgaaggcggtaacggcggcaaatcaggataagccgctgctgggcttg
ttctccgacggcaacatgccggttcgctgggaaggcccgaaagcctcttatcacggcaac
cttgaacaacctgcggtgacctgcaaggcaaacccgcagcgcgatgataccgtgcctacg
ctggcgcaaatgacggacaaagcgattgagctgttgagtaagaatgaaaaaggtttcttc
ttgcaggttgaaggcgcgtctatcgataaacaggatcacgccgccaacccatgcgggcag
attggtgaaacggtcgatctggacgaagccgtacagcgtgcgctcgcattcgctaaaaaa
gagggcaataccctggttgtggtgactgccgatcatgcgcattccagccagattatcgcg
ccggaaagcaaagcgccgggactgacgcaggcgttaaataccaaagatggcgcggtgatg
gtcatcagctacggcaactcggaagaggagtcgcaggaacataccggcagccagttgcgc
attgccgcatacggcccgcatgcggcgaatgtcgtcggattaacggaccagaccgatctg
ttctacaccatgaaagcggcgttgggactgaagtaa

DBGET integrated database retrieval system