KEGG   Citrobacter koseri: CKO_02797Help
Entry
CKO_02797         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cko  Citrobacter koseri
Pathway
cko00473  D-Alanine metabolism
cko00550  Peptidoglycan biosynthesis
cko01100  Metabolic pathways
cko01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKO_02797
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKO_02797
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CKO_02797
Enzymes [BR:cko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CKO_02797
Peptidoglycan biosynthesis and degradation proteins [BR:cko01011]
 Precursor biosynthesis
  Amino acid ligase
   CKO_02797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ABV13903
UniProt: A8AK90
LinkDB All DBs
Position
2591349..2592464
Genome map
AA seq 371 aa AA seqDB search
MEWVFKMAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKARFDVVLLGIDKQGQWHVSDA
ENYLLNANDPAHIALRPSSTSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDG
SLQGMLRVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFITLTRANRDAIRFAEV
ASRLGLPLFVKPANQGSSVGVSKVTSEAQYEQAVALAFEFDHKVVVEQGIKGREIECAVL
GNDHPQASTCGEIVLNSDFYAYDTKYIDGNGAQVVVPAQIPQEVNDKIRQIAIQAYQTLG
CAGMARVDVFLTAENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERH
AADNALKTSML
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggtttttaagatggcaaaattgcgggtaggtatcgtatttggtggtaaatca
gcggaacatgaagtgtctttgcaatcggcaaaaaatattgtcgatgccatcgacaaagcc
cgctttgacgttgtgctgttaggcattgataaacaagggcaatggcatgtcagcgatgcc
gaaaactatctgctgaatgcaaacgaccccgcgcacattgcgctgcgcccctcttctacc
agcctggcgcaggttccgggcaaacacgaacaccagttaattgacgcacagaacggccag
ccattgccgacggtggacgtcattttcccgatcgtacacggcacgctgggggaagacggg
tcgctgcaagggatgctgcgcgtagcgaatttaccgtttgtcggctccgatgtgctgggt
tccgccgcctgtatggataaagacgtcaccaaacgtctgctgcgcgatgccgggctgaac
atcgcgccgtttattacgctgactcgcgcgaatcgcgatgcgatccgttttgcggaagtg
gcgtcccgtctgggtctgccgctgtttgtgaaacccgcaaatcagggctcctctgtgggc
gtcagcaaagtcaccagcgaagcgcaatatgaacaggccgttgcgctggcgttcgaattc
gatcacaaagtggttgttgagcaagggatcaaaggccgtgagatcgagtgcgccgtgctg
ggcaacgatcacccgcaggccagcacctgcggcgagatcgtcctgaacagcgatttttac
gcttacgacaccaaatatatcgacggcaacggggcgcaggtcgtggttcccgcccaaatc
ccgcaagaggtgaacgacaagatccgccagatcgccattcaggcgtaccagacgttaggt
tgcgcgggaatggcgcgcgtggacgtcttcttaacagcggaaaacgaggtggtgattaac
gagatcaatacgctgccgggattcaccaacatcagcatgtacccgaaactctggcaggca
agtggcttagggtataccgatttgattacccgtctaattgaactggcgctggaacgtcat
gcggcggataacgccctgaaaaccagcatgttatga

DBGET integrated database retrieval system