KEGG   Citrobacter koseri: CKO_03539
Entry
CKO_03539         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
cko  Citrobacter koseri
Pathway
cko00480  Glutathione metabolism
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CKO_03539
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cko01002]
    CKO_03539
Enzymes [BR:cko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     CKO_03539
Peptidases and inhibitors [BR:cko01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   CKO_03539
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Other DBs
NCBI-ProteinID: ABV14618
UniProt: A8AMA5
LinkDB
Position
3297272..3298783
AA seq 503 aa
MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISALLRRGELEGKPGQTL
LLHHVPNVLSERILLIGCGKERELDERQYKQVIQKTINTLNDTGSMEAVCFLTELHVKGR
NNYWKVRQAVETAKETLYSFDQLKTNKSEPRRPLRKMVFNVPTRRELTSGERAIQHGLAI
AAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRVIGEQQMKELGMHSYLAVG
HGSQNESLMSVIEYKGNPSEDARPVVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAAAV
YGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVLTTMSGQTVEVLNTDAEGRLVLC
DVLTYVERFEPEAVIDVATLTGACVIALGHHITGLMSNHNPLAHELISASEQAGDRAWRL
PLGDEFQEQLESNFADIANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAGTAWRSGKAKG
ATGRPVALLSQFLLNRAGFNGEE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggagttcagtgtaaaaagcggtagcccggagaaacagcggagtgcctgcatcgtcgtg
ggcgtctttgaaccacgccgcctttctccgattgcagaacagctcgataaaatcagcgac
gggtacatcagcgccctgctgcgtcgtggtgaactggaaggaaaaccggggcagaccctg
ttgctgcaccatgttcctaacgttctttccgagcgaatcctcctcattggttgtggtaaa
gagcgcgagctcgatgagcgccagtacaagcaggtcattcagaaaaccatcaatacgctg
aatgacaccggctcaatggaagcggtctgcttcctgaccgaactgcacgtcaaaggccgc
aacaactactggaaagtacgtcaggctgtcgaaacggccaaagagacgctgtacagcttt
gatcaactgaagaccaacaagagcgagccgcgtcgcccgctgcgtaaaatggtcttcaac
gtgccgacccgccgcgagctgaccagcggcgagcgtgcgatccaacacggtctggcgatt
gccgccgggattaaagcggcgaaagatctcggcaatatgccgccgaatatctgtaatgcc
gcctacctggcctctcaggcgcgccagttggctgacagctacagcaagaacgtcatcacc
cgcgtcatcggcgaacagcagatgaaagagctgggtatgcactcttatctggcggtcggt
cacggttcgcagaacgaatcgctgatgtcggttatcgaatacaaaggcaacccgtccgaa
gacgcgcgtccggttgtgctggtcggcaaagggctgacctttgactccggcggcatctcc
atcaagcctgccgaaggcatggacgagatgaagtacgatatgtgcggcgcggcggcagtg
tacggcgtgatgcgcatggtcgcggaacttcagttgccgattaacgtcatcggcgtgctg
gcaggctgcgaaaacatgcctggcgggcgagcgtatcgtccgggtgacgtgctgaccacc
atgtccggccagacggtcgaagtgctgaacaccgatgccgaaggccgcctggtactgtgc
gacgtgttaacctacgttgagcgttttgagccggaagcggtgattgacgtcgcgaccctg
acgggcgcctgcgtgattgcgctgggccatcacatcaccggtctgatgtcgaaccacaat
ccgctggcgcatgaactgattagcgcgtccgaacaggcgggcgaccgcgcatggcgcttg
ccgttgggcgatgagttccaggaacagctggagtctaactttgcggatatagcgaacatc
ggcggccgtcctggcggcgcaatcaccgccggttgcttcctgtcgcgctttacccgtaag
tacaactgggcgcacctggacatcgccggcaccgcatggcgttccggcaaagcgaaaggc
gcaaccggtcgtccggtggcgttgctgtcgcagttcctgctcaatcgcgcgggttttaac
ggcgaagagtaa

DBGET integrated database retrieval system