KEGG   Citrobacter koseri: CKO_03857Help
Entry
CKO_03857         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cko  Citrobacter koseri
Pathway
cko00473  D-Alanine metabolism
cko01100  Metabolic pathways
cko01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKO_03857
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CKO_03857
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cko01011]
    CKO_03857
Enzymes [BR:cko01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CKO_03857
Peptidoglycan biosynthesis and degradation proteins [BR:cko01011]
 Precursor biosynthesis
  Racemase
   CKO_03857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABV14933
UniProt: A8AN69
LinkDB All DBs
Position
complement(3590627..3591706)
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFEATDLPVISAQHLHTAVHNEEQLAALEAAGLDEPVTVW
MKLDTGMHRLGVRPEKAEAFYQRLTQCKNVRQPVNIVSHFARADEPECGATEQQLDIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLENQSTGEDFGCQPVMSLISS
LIAVREHKAGEPVGYGGTWISERDTCLGVVAMGYGDGYPRAAPSGTPVLVNGREVTIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgtagtcattaaccgccgcgctctgcgacacaatctgcaacgtctg
cgtgaactggcgcctgccagcaagctggttgcggtcgtgaaagcgaacgcttacggacac
ggtcttctggagaccgcgcgaacgctccctgatgccgacgctttcggcgtcgcccgcctt
gaagaagccctgcgcctgcgggcgggcgggatcacgcagcccattctgttgctggaaggt
ttttttgaagccaccgatctgccagtcatctctgcgcagcatctgcataccgccgtgcat
aacgaagaacagcttgccgcgctggaagccgccgggctggatgagccggtaacggtgtgg
atgaaactggatacgggaatgcatcgtctgggcgtgcgtcctgaaaaagccgaagcgttt
tatcaacggcttacgcagtgtaaaaacgtgcgccagccggtaaatatcgtcagccatttt
gcccgcgccgatgagccggaatgcggcgcgaccgagcagcaactcgatatttttaatacc
ttctgcgaaggtaaaccggggcaacgctccatcgccgcttccggcggcatcctgctgtgg
ccgcagtctcattttgactgggcgcgaccgggcatcatcctctatggcgtctcgccgctg
gaaaatcagtccactggcgaagattttggctgccagccggtcatgtcgctaatctccagc
ctcattgccgttcgcgagcataaagcgggcgaaccggtgggttacggcggcacatggatc
agcgagcgcgatacgtgtctgggcgtggttgctatgggctatggcgacggttatccgcgc
gcggcgccgtccggtacgccggtgctggttaatggtcgggaagtgacgattgttggtcgc
gtggcgatggacatgatctgcgtcgatttaggccctcaggcgcaggacaaagcaggcgat
ccggtcattttgtggggtgaaggtctgcccgttgagcgcattgcggaaatgacaaaagtg
agtgcttacgaacttatcacacgcctgacatcaagggttgcgatgaagtacatcgattaa

DBGET integrated database retrieval system