KEGG   Citrobacter koseri: CKO_04009Help
Entry
CKO_04009         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
cko  Citrobacter koseri
Pathway
cko00250  Alanine, aspartate and glutamate metabolism
cko00280  Valine, leucine and isoleucine degradation
cko00310  Lysine degradation
cko00410  beta-Alanine metabolism
cko00640  Propanoate metabolism
cko00650  Butanoate metabolism
cko01100  Metabolic pathways
cko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CKO_04009
   00650 Butanoate metabolism
    CKO_04009
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CKO_04009
   00280 Valine, leucine and isoleucine degradation
    CKO_04009
   00310 Lysine degradation
    CKO_04009
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKO_04009
Enzymes [BR:cko01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CKO_04009
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CKO_04009
    2.6.1.48  5-aminovalerate transaminase
     CKO_04009
Amino acid related enzymes [BR:cko01007]
 Aminotransferase (transaminase)
  Class III
   CKO_04009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABV15081
UniProt: A8ANL8
LinkDB All DBs
Position
3733837..3735120
Genome map
AA seq 427 aa AA seqDB search
MSSNKELMHRRSNAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
EIVSAVEAQLKKLSHTCFQVLAYEPYLELCELMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGISD
DDAIASIQRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQTGVAPDLTTFAKSIAGGFPLAGVTGRADVMDAIPPGGLGGTYAG
NPLACAAALAVLNIFEQENLLQKAKDLGQTLRKGLLNIAETHREIGDVRGPGAMIAIELF
ENGDRSKPDAKLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIQQGLDIIAQC
FDEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagaattaatgcatcgccgcagtaacgccgtccctcgcggcgtagga
cagatccaccctatttttgccgatcgcgcggaaaactgccgggtctgggatgtggaaggc
cgcgagtatctcgattttgcaggcggtattgcggtgttgaataccgggcacctgcacccg
gagatcgtctcggcggtcgaagcacaactgaaaaagctgtcgcatacctgttttcaggta
ctcgcctacgagccgtatctggagctgtgcgaactcatgaaccagaaggtgccaggcgat
ttcgcgaagaaaaccctgctggtgactaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgtgcggcgacaaagcgtagcggcgccatcgcttttagcggtgcctatcatggc
cgtacccactacaccctgtcgctgaccggaaaagtcaatccctactctgccggaatgggg
ctgatgccaggccacgtttaccgcgcgctctacccttgcgccctgcacggcatcagtgat
gatgatgcgattgccagcatccagcgcatctttaaaaacgatgccgcgccggaagatatt
gccgccatcatcattgaaccggtacagggagaaggcggtttttatgcggcctcgcccgct
tttatgcagcgtctgcgcgcactctgcgacgaacacgggatcatgctcattgccgatgaa
gtgcaaagcggcgcggggcgtaccggtacgcttttcgcgatggaacagacgggcgtcgcc
ccggacctcaccaccttcgccaaatcgattgccggcggctttccgctggcgggagtaacc
ggtcgcgccgatgtgatggacgccatcccgccgggcggtctgggcggcacctacgccggt
aatcctctcgcctgcgccgccgcgctggcggtactgaacattttcgagcaggaaaacctg
ctgcaaaaagccaaagacctggggcaaaccctgcgtaaagggctgctgaatattgctgaa
acgcaccgcgagattggcgacgtgcgcggcccgggagcgatgatcgccattgagctgttt
gaaaatggcgatcgcagcaaaccggacgcgaaactgaccgccgacatcgtcgcccgcgcc
cgtgataaagggctgatcctgctctcctgcgggccgtactacaacgtgctgcgcattctg
gtgccgctgactatcgaagaagcgcaaattcagcaagggctggacatcatcgctcagtgt
tttgatgaggcgaagcaaggttag

DBGET integrated database retrieval system