KEGG   Citrobacter koseri: CKO_04745Help
Entry
CKO_04745         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
cko  Citrobacter koseri
Brite
KEGG Orthology (KO) [BR:cko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cko03012]
    CKO_04745
   03029 Mitochondrial biogenesis [BR:cko03029]
    CKO_04745
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cko04147]
    CKO_04745
Translation factors [BR:cko03012]
 Eukaryotic Type
  Elongation factors
   CKO_04745
 Prokaryotic Type
   CKO_04745
Mitochondrial biogenesis [BR:cko03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CKO_04745
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CKO_04745
  Exosomal proteins of breast cancer cells
   CKO_04745
  Exosomal proteins of colorectal cancer cells
   CKO_04745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ABV15790
UniProt: A8AQM7
LinkDB All DBs
Position
complement(4353422..4354651)
Genome map
AA seq 409 aa AA seqDB search
MLSPEGESTIVRNIAVSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAAR
AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
VAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPG
DDTPIVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRG
TVVTGRVERGIIKVGEEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKRE
EIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELP
EGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVMS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgctctctcctgaaggggagagcactatagtaaggaatatagccgtgtctaaagaaaaa
tttgaacgtacaaaaccgcacgttaacgtcggcaccatcggccacgttgaccatggtaaa
actactctgactgctgcaatcactaccgtactggctaaaacctacggcggtgctgctcgt
gcattcgaccagatcgataacgcgccggaagaaaaagctcgtggtatcaccatcaacact
tctcacgttgaatacgacaccccgactcgccactacgcgcacgtagactgcccgggccac
gccgactatgttaaaaacatgatcaccggtgctgcgcagatggacggcgcgatcctggtt
gttgctgcgactgacggcccgatgccgcagacccgtgagcacatcctgctgggtcgtcag
gtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatggttgatgacgaagag
ctgctggaactggttgagatggaagtgcgtgaactgctgtctcagtacgatttcccgggc
gacgacacgccgatcgttcgtggttctgctctgaaagcgctggaaggcgaagctgagtgg
gaagcgaaaatcatcgaactggctggctacctggattcttacatcccggaaccagagcgt
gcgattgacaagccgttcctgctgccgatcgaagacgtattctccatctccggtcgtggt
accgttgttaccggtcgtgtagagcgcggtatcatcaaagtgggcgaagaagttgaaatc
gttggtatcaaagagactgcgaagtctacctgtactggcgttgaaatgttccgcaaactg
ctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgtggtatcaaacgtgaa
gaaatcgaacgtggtcaggtactggctaagccgggttccatcaagccgcacaccaagttc
gaatctgaagtgtacattctgtccaaagatgaaggcggccgtcatactccgttcttcaaa
ggctaccgtccgcagttctacttccgtacaactgacgtgactggcaccatcgaactgccg
gaaggcgtagagatggtaatgccgggcgacaacatcaaaatggttgttaccctgatccac
ccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggcggccgtaccgttggc
gcgggcgttgttgctaaagtaatgagctaa

DBGET integrated database retrieval system