KEGG   Citrobacter koseri: CKO_04812Help
Entry
CKO_04812         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cko  Citrobacter koseri
Pathway
cko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01130  Biosynthesis of antibiotics
cko01230  Biosynthesis of amino acids
Module
cko_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKO_04812
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CKO_04812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 TsaE APS_kinase ABC_tran AAA_7 AAA_5 AAA_17 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_28 His_biosynth AAA_25 AAA_29 RsgA_GTPase PduV-EutP AAA_2 Mg_chelatase AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: ABV15857
UniProt: A8AQU4
LinkDB All DBs
Position
complement(4411254..4411775)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgtagaaggtgaagacggcttccgt
gatcgcgaagaaaaagtcatcaacgagttgacggaaaaacagggtattgtgctggcaacc
ggcggtggctctgtaaaatcacgtgaaacgcgtaaccgtctctccgcgcgtggcgtcgtg
gtgtatcttgaaacgacaatcgaaaaacaacttgcgcgtacgcagcgcgacaagaaacgc
ccgctgttgcaggtagaagctccgcctcgtgaagttctggaagcgttggccaacgaacgc
aatcctctgtatgaagagattgccgacgtgaccattcgtaccgacgatcagagcgctaag
gtcgtggcaaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system