KEGG   Corynebacterium kroppenstedtii: ckrop_1208Help
Entry
ckrop_1208        CDS       T00896                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00473  D-Alanine metabolism
ckp00550  Peptidoglycan biosynthesis
ckp01100  Metabolic pathways
ckp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ckp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ckrop_1208 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ckrop_1208 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ckrop_1208 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ckp01011]
    ckrop_1208 (ddlA)
Enzymes [BR:ckp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ckrop_1208 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ckp01011]
 Precursor biosynthesis
  Amino acid ligase
   ckrop_1208 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 ATPgrasp_ST CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACR17952
UniProt: C4LJE7
LinkDB All DBs
Position
complement(1434116..1435354)
Genome map
AA seq 412 aa AA seqDB search
MPLHLVPVTTSEPSSASSADITSQSASPLVASTQSGPGAGGERDENSGHNEHSRIRVAVV
YGGRSSEHSISCVSAGAVISHLDPDRYQVVPIGITRDGRWVVGSSDPKELSIRERQLPEV
KAGTSLSLSLDPQHAGRFVYADGPDVGQVFADVDVIFPVLHGGFGEDGTVQGLFDMASVP
YVGAGVLASAASMDKEFTKKLAAAEGLPIGRDVVLRETRSLTEEEKNLLGLPVFVKPARG
GSSIGISKVDQWDELDDALDLARQHDSKVIVESMIVGTEVECGVLQRPDGTVEASLPAQL
EDTESGDEGFYGFDTKYLDNVITAQIPPHFDDDTIRHIRELAVETFHALDCEGLARIDFF
VTDRGPVLNEINTMPGFTPISMYPQMFGAMGIDYPDLLDLLIQRAMVAHPGA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctacacttagtccccgtgactacatctgaaccttcatctgcctcgtcggcggac
atcacatcgcagtcggcatcgcccctggttgcttctactcaatcaggtccgggtgctggc
ggggagcgcgacgagaacagcggccataacgagcacagtcgcatccgcgtcgccgtcgtt
tatggtgggcgtagttctgagcattccatttcgtgtgtgtctgcgggcgccgtgatttct
cacctggaccccgaccgttaccaggtcgttccgatcggtatcacgagagatgggcgctgg
gtagtggggtcctcggatccgaaagagctatccattcgtgagcggcagctgccggaagtg
aaggccggcaccagcttgtcgttatcactcgatccgcagcacgctggacgttttgtctat
gcggatggccccgacgttggtcaggtctttgcggacgtcgacgtcattttccctgtcctt
catgggggtttcggtgaagacggtaccgtacaagggctcttcgacatggcgtccgtcccg
tatgtcggtgcaggtgtattggcgtcggcggcgtcgatggacaaagagttcaccaagaaa
ctggccgcggcggaagggctccccattggccgtgacgtcgtcctccgcgagacgcgctcc
ctgaccgaggaggaaaagaatcttctgggcctgccggtgttcgtgaagcctgctcgaggc
ggatcctccatcggtatttccaaggttgaccagtgggatgaacttgatgacgctctcgat
ctggcgcgtcagcatgattccaaggtcatcgtagagtccatgattgtgggcacggaagtg
gagtgcggcgttcttcagcggccagatggcaccgttgaggcctcccttcccgcgcagctc
gaggacactgagtcgggtgacgaagggttctacggtttcgacacaaagtacctggataac
gtcattacagcgcagattccaccgcactttgacgacgacaccatccgccacatccgcgaa
ctcgctgtggagaccttccacgccttggattgtgaaggcctggcacgcattgatttcttc
gtgacagaccgtggtccggtgctgaacgagatcaacaccatgcctgggttcacgccgatc
tcgatgtatccacaaatgtttggtgcgatggggattgactatcccgacctcttggatctc
ctgattcaacgtgcgatggtggcccaccccggggcctaa

DBGET integrated database retrieval system