KEGG   Corynebacterium kroppenstedtii: ckrop_1849Help
Entry
ckrop_1849        CDS       T00896                                 

Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
ckp  Corynebacterium kroppenstedtii
Brite
Translation factors [BR:ckp03012]
 Eukaryotic Type
  Elongation factors
   ckrop_1849
 Prokaryotic Type
   ckrop_1849
Mitochondrial biogenesis [BR:ckp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ckrop_1849
Exosome [BR:ckp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ckrop_1849
  Exosomal proteins of breast cancer cells
   ckrop_1849
  Exosomal proteins of colorectal cancer cells
   ckrop_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACR18568
UniProt: C4LL63
LinkDB All DBs
Position
complement(2152509..2153699)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFDRSKPHVNIGTIGHVDHGKTTTTAAITKVLSEKYPEENQAFAFDAIDKAPEEKE
RGITINIAHVEYSTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEDLIELVEMEVRELLAEQDFDEDAPIVHISALKAL
EGDEKWEQSILDLMDACDESIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGKLNI
NDDVEILGIKEKSQNTTVTGIEMFRKQLDYAEAGDNCGLLLRGTKREDVERGQIVAKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGGRTVGAGRVTKINK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggctaagttcgatcggagcaagccgcacgtaaacatcggtaccatcggtcac
gttgaccacggtaagaccaccactaccgctgctatcaccaaggttctgtcggagaagtac
cccgaagagaaccaggctttcgctttcgacgccatcgataaggcgccggaggagaaagag
cgcggtattaccattaacatcgctcacgtcgagtactccaccccgaagcgtcactacgct
cacgtggatgctccgggccacgccgactacatcaagaacatgatcaccggtgctgcccag
atggacggcgcgatcctcgtcgtcgctgctaccgacggcccgatgcctcagacccgcgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctctgaacaagtgc
gacatggttgatgatgaggacctcatcgagctcgtcgaaatggaagttcgtgaactcctc
gctgagcaggacttcgacgaagatgcacctatcgttcacatctccgctctgaaggctctt
gagggcgacgagaagtgggagcagtccattctcgacctcatggatgcctgcgacgagtcc
atcccggatccggttcgtgaaaccgacaagcccttcctcatgccgattgaggacatcttc
accattaccggccgcggcaccgttgtcaccggtcgtgtggagcgcggcaagctgaacatc
aacgatgatgttgaaattctgggcatcaaggagaagagccagaacaccaccgtcaccggt
atcgagatgttccgcaagcagctcgactacgcagaggctggcgacaactgtggtctgctt
ctccgtggtaccaagcgtgaggacgttgagcgtggccagatcgtggctaagcccggcgca
tacacccctcacaccgagttcgagggttccgtctacgtcctgtccaaggacgagggcggc
cgtcacaccccgttcttcgacaactaccgcccgcagttctacttccgcaccaccgacgtt
accggtgttgtgaagctcccggagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccttgatccagccggtcgctatggacgaaggcctccgcttcgctatccgc
gaaggtggccgcaccgttggcgccggtcgtgtgaccaagatcaacaagtaa

DBGET integrated database retrieval system