KEGG   Clostridium kluyveri NBRC 12016: CKR_2584Help
Entry
CKR_2584          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00473  D-Alanine metabolism
ckr00550  Peptidoglycan biosynthesis
ckr01100  Metabolic pathways
ckr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ckr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKR_2584
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKR_2584
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CKR_2584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ckr01011]
    CKR_2584
Enzymes [BR:ckr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CKR_2584
Peptidoglycan biosynthesis and degradation proteins [BR:ckr01011]
 Precursor biosynthesis
  Amino acid ligase
   CKR_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK ATP-grasp GARS_A CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: BAH07635
UniProt: B9E560
LinkDB All DBs
Position
2906464..2907357
Genome map
AA seq 297 aa AA seqDB search
MKVGIIMGGISSEREVSLNSGKSIINYMDKNKYEIVPIVIDKKNDVFEKVKDIDFAFIAL
HGKFGEDGIIQSVFQTMDIPYSGCSPLTSGICMDKDISKKLLYSANINTAEWICIKSIEN
IDYDYLEKMGYPVVVKPNSGGSSVATTIIEKSEDIEEAARLAFNYDEEVMIEKYIEGDEI
TCCILDGTALPILAIKPNKGSFFDYTSKYADGGSEEIVVEFEKPLQSKIEEISLKCWELF
KCKGYVRVDMILKDKVPYVLELNTLPGLTKNSLFPKSANGVNISFTELLDKIIQCSM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaggaattataatgggtgggatatcttcagaaagagaagtttccctaaattca
ggaaaatccataataaactatatggataaaaataaatatgaaatagtacctattgttata
gataagaaaaatgatgtatttgaaaaagtaaaagatatagattttgcctttattgctctt
catggcaaatttggtgaggatggtataatacaatccgttttccaaaccatggatatacct
tattcaggctgcagccccttaaccagcggcatctgtatggataaggacataagtaagaaa
ctgctatattctgccaatataaatacagcagaatggatatgtataaaatccatagagaat
attgattatgactacttagaaaagatggggtatcctgtagttgtaaaaccaaattccggt
ggttcaagtgtagcaactactataatagaaaagagtgaagatatagaagaagctgctcgt
cttgcctttaattacgatgaggaagttatgattgaaaaatatatagaaggagacgaaata
acttgttgtatattagacggaactgccctacccatacttgccataaaacctaataagggt
tctttctttgattacacttcaaaatatgcagatggcggttctgaagaaatagtagtagaa
tttgaaaaaccacttcaaagtaagattgaagaaatatccctaaagtgctgggaactattc
aaatgcaaaggctatgtccgagtagacatgatattaaaagataaagttccctatgtactt
gagcttaatactctgccgggacttacaaaaaatagtcttttcccaaaaagcgctaatggg
gtaaatatatccttcacagaactattagataaaataattcaatgttctatgtaa

DBGET integrated database retrieval system