KEGG   Corynebacterium kutscheri: UL82_01130Help
Entry
UL82_01130        CDS       T03866                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cku  Corynebacterium kutscheri
Pathway
cku00020  Citrate cycle (TCA cycle)
cku00190  Oxidative phosphorylation
cku00650  Butanoate metabolism
cku01100  Metabolic pathways
cku01110  Biosynthesis of secondary metabolites
cku01120  Microbial metabolism in diverse environments
cku01130  Biosynthesis of antibiotics
cku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UL82_01130 (sdhA)
   00650 Butanoate metabolism
    UL82_01130 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UL82_01130 (sdhA)
Enzymes [BR:cku01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UL82_01130 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     UL82_01130 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO NAD_binding_8 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AKE40458
UniProt: A0A0F6R0J5
LinkDB All DBs
Position
241588..243600
Genome map
AA seq 670 aa AA seqDB search
MSTYSDTARPAFNHPESIVPGVRPGTVLDSHEPHGVPKKEMWEYQKNHMELVSPLNRRKF
HILVVGTGLSGGGAAAALGELGYNVKVFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAY
RHVKDTIKGGDYRGRESDCWRLAYESVRVIDHMNAIGAPFAREYGGALATRSFGGVQVSR
TYYTRGQTGQQLQLSTASALQRQIHLGTVEIFTHNDMHDLIITEKDGQKRCEGLIMRNMI
SGELVAHTGHAVILATGGYGNVFHMSTLAKNSNAGAIMRAYEHGAYFASPSFIQFHPTGL
PVNSEWQAKTILMSESLRNDGRVWSPIVAGDDRDPNTIPEEERDYFLERRYPAFGNLVPR
DVASRAISQQINKGLGVGPLHNAAYLDFRDSIERLGQSTIRERYSNLFQMYEEAIGENPY
TVPMRIAPTCHFTMGGLWTDFNEMTSIPGLFAAGECSWTYHGANRLGANSLLSASVDGWF
TLPFSVPNFLAGHLGEERLSDDAPEVKAALARAQARIDRLMNIKGDNPHGPEYYHRQLGE
ILYFSCGVARNIEDLKSGIEKIRALRKDFWANMRMVGRTDEMNQVLEYAMRVADYIDLGE
LMCVDALDRDESCGAHFRDDHLSEEGEAERDDENWCFVSAWEPGKAEGEFIRHAEPLTFE
SIPLMTRNYK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttactctgacaccgctcgccctgcgttcaaccacccagaatccatcgttcct
ggcgttcgtcctggtacggttttggactcgcacgagccgcacggcgttcctaaaaaagaa
atgtgggagtaccaaaaaaaccacatggaattggtctccccgcttaaccgtcgtaaattc
cacattcttgtggttggtaccggtctttccggcggtggcgcagcagccgctcttggcgag
ctcggctacaacgtcaaggtatttacctatcatgacgcccctcgtcgtgcgcactctatt
gccgcacagggtggcgtgaactccgctcgtggtaagaaggttgacaacgacggcgcatat
cgccacgtcaaagacaccattaaaggtggcgactaccgtggtcgtgaatcggactgctgg
cgcttggcgtatgagtccgttcgcgtgatcgaccacatgaatgctatcggtgcacctttt
gctcgcgaatacggtggggccttggctactcgttccttcggtggtgtgcaggtttctcgt
acctattacactcgtggtcaaaccggccagcagttgcagctgtctaccgccagcgcattg
cagcgtcagattcacttgggcactgtggagatttttacccacaacgatatgcacgacctc
atcattactgagaaggatgggcagaagcgttgcgagggcttgatcatgcgtaacatgatc
agcggtgaattggttgctcacaccggtcatgctgttatcttggctaccggcggttatggc
aacgttttccacatgtcaaccctggcaaagaactccaatgcgggcgcgattatgcgcgcc
tatgagcatggtgcttactttgcgtcgccatcgtttattcagttccacccaaccggtttg
ccggtgaactccgaatggcaggcaaagaccattcttatgtctgagtctttgcgtaacgac
ggacgtgtgtggtcacctatcgttgctggcgatgaccgcgatccgaacactatccctgaa
gaagagcgtgattacttcctggagcgccggtaccctgccttcggtaacctggtgcctcgc
gacgtggcttcgcgtgcaatttctcagcagatcaataagggcctaggtgtggggccactg
cacaatgctgcttacctagacttccgtgactccatcgagcgccttggccagagcaccatt
cgtgagcgttactccaacctcttccaaatgtatgaagaggctattggcgaaaacccatat
acggtgccaatgcgtatcgccccaacatgccacttcactatgggtggcctgtggaccgac
tttaatgaaatgacctctatcccaggtcttttcgctgctggtgagtgctcttggacttac
cacggtgcaaaccgtctgggcgcaaactccctgctttcggcatcggttgatggttggttc
accctgccatttagcgtgccaaacttcctagccggacacctaggtgaagagcgtctttct
gacgacgctccagaggttaaggctgctcttgcccgtgcccaagcacgtattgatcgtttg
atgaatatcaagggcgataatccacacggacctgagtactatcaccgccagctcggtgaa
atcctgtacttctcttgtggtgtggctcgcaatattgaggaccttaagtccggcatcgag
aagattcgtgctctacgcaaggacttctgggcaaatatgcgcatggttggccgtaccgac
gagatgaaccaagttctggaatacgcaatgcgcgtagccgactacattgaccttggcgag
ctgatgtgcgtggacgcacttgaccgcgatgagtcctgtggtgctcacttccgtgacgat
cacctctccgaagaaggcgaggcagagcgtgacgacgaaaactggtgcttcgtttccgca
tgggagccaggcaaagctgaaggcgagttcatccgccacgcagagccgctcaccttcgaa
tcgatcccgctgatgacaaggaactacaagtaa

DBGET integrated database retrieval system