KEGG   Corynebacterium kutscheri: UL82_01135Help
Entry
UL82_01135        CDS       T03866                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cku  Corynebacterium kutscheri
Pathway
cku00020  Citrate cycle (TCA cycle)
cku00190  Oxidative phosphorylation
cku00650  Butanoate metabolism
cku01100  Metabolic pathways
cku01110  Biosynthesis of secondary metabolites
cku01120  Microbial metabolism in diverse environments
cku01130  Biosynthesis of antibiotics
cku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UL82_01135
   00650 Butanoate metabolism
    UL82_01135
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UL82_01135
Enzymes [BR:cku01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UL82_01135
    1.3.5.4  fumarate reductase (quinol)
     UL82_01135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_17 Fer4_9 Fer4 Fer4_18 Fer4_15 Fer4_16 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_3 Fer4_22 Fer4_13 Fer2
Motif
Other DBs
NCBI-ProteinID: AKE40459
UniProt: A0A0F6TCK3
LinkDB All DBs
Position
243600..244349
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPNDEGHFESVTVEDAVAQMSILELLDHVNSGLIEEGKEPFAFASDCRE
GICGTCGLMVNGRPHGLEKNKPSCHQRLESVADGATLKIEPFRSAAYPVIKDMVVDRSAL
DRVMQEGGYVSVNAGTAPDADTLHMNHQTAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLMPLGKEERGRRARKMVDELETNFGHCSLYGECADVCPAGIPLTAVAAINKERA
RAAFSAKDH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccatcttgaaatctggcgtcaggctgggccaaacgacgaaggtcactttgag
tctgtcacggtcgaagacgccgtagcacaaatgtctattctggagttactggatcacgtt
aactccggtctgatcgaagagggcaaagaaccattcgctttcgcttcagactgccgcgaa
ggtatttgcggtacctgtggtctgatggttaatggccgcccacacggtttggaaaagaac
aagccttcttgccaccagcgtctagaaagcgttgctgatggtgcgaccttgaagattgaa
cctttccgatccgctgcatacccagtgattaaggatatggtcgtcgaccgttccgcactt
gatcgcgtgatgcaagaaggcggctacgtttcggtgaacgctggtaccgcgcctgatgcg
gataccttgcacatgaaccaccaaaccgctgagcttgcacttgatcacgcagcgtgtatc
ggctgtggtgcttgcgtcgctgcctgcccgaacggtgcagcccacctatttactggtgcg
aagctagttcacctttcgcttatgccattgggtaaggaagaacgtggacgtcgtgcccgt
aagatggttgacgagttggaaaccaactttggacactgctccttatatggcgagtgtgct
gatgtttgcccagcaggtattccattgaccgctgttgccgcgatcaataaggaacgcgcc
cgcgcagcatttagcgccaaggatcattaa

DBGET integrated database retrieval system