KEGG   Corynebacterium kutscheri: UL82_06030Help
Entry
UL82_06030        CDS       T03866                                 

Gene name
ppgK
Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cku  Corynebacterium kutscheri
Pathway
cku00010  Glycolysis / Gluconeogenesis
cku00520  Amino sugar and nucleotide sugar metabolism
cku01100  Metabolic pathways
cku01110  Biosynthesis of secondary metabolites
cku01120  Microbial metabolism in diverse environments
cku01130  Biosynthesis of antibiotics
cku01200  Carbon metabolism
Module
cku_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UL82_06030 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    UL82_06030 (ppgK)
Enzymes [BR:cku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     UL82_06030 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AKE41372
UniProt: A0A0F6QZW6
LinkDB All DBs
Position
1282249..1283001
Genome map
AA seq 250 aa AA seqDB search
MENVGFGIDVGGSGIKGARVDLATGEFIGERIKILTPQPATPDAVAETIAEIIRQAQWDG
PVGITLPSVIKNGVARSAANIDPSWVNTDTTELFARHLGEREISVLNDADAAGLAEVNFG
DEHARHGAVILLTLGTGIGSAVLIDGALFPNTELGHLEVDGKEAEHRASSAVKDREELSY
KQWTKRLTKVLKVYEALFNPTIFIIGGGISRKFDKWGPMLDINTPIVPASLRNRAGIVGA
ALAVRDQLHP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgtaggttttggtattgatgttggtggctctggaatcaaaggagcccgggtg
gatctagccacaggtgaattcatcggtgaacggattaagatccttactccacaaccagca
actcccgatgcagtagcagaaaccatcgccgaaattatccgacaagctcaatgggatggt
ccggtaggtattactttgcccagtgtgatcaaaaatggtgttgcgcgcagtgccgctaat
attgatccgtcttgggtaaacaccgataccaccgaattatttgctcggcacttaggtgaa
cgggaaatttctgtcctcaacgatgctgatgcagcaggtcttgccgaagttaattttggt
gatgagcatgctcgccacggcgcggttattctcttaactttagggaccggaattggctct
gcggtacttatcgatggtgcactttttcccaacactgaactaggccatctagaagttgat
ggtaaagaagctgaacatcgcgcttcttctgcggtcaaagatcgtgaagaactcagctat
aagcaatggacaaaacgtctgaccaaagtattaaaagtctatgaagctttatttaatccc
actatttttattattggcggtggaatttctcgcaaattcgataagtggggtccaatgtta
gatattaataccccgattgttccagctagcttgcgtaatcgtgctggaattgtcggcgcg
gcacttgcggtacgagatcaactacatccctaa

DBGET integrated database retrieval system