KEGG   Campylobacter lari RM2100: CLA_0205Help
Entry
CLA_0205          CDS       T00858                                 

Gene name
pfs
Definition
(GenBank) multifunctional 5'-methylthioadenosine / S-adenosylhomocysteine nucleosidase / 6-amino-6-deoxyfutalosine hydrolase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
cla  Campylobacter lari RM2100
Pathway
cla00130  Ubiquinone and other terpenoid-quinone biosynthesis
cla00270  Cysteine and methionine metabolism
cla01100  Metabolic pathways
cla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CLA_0205 (pfs)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CLA_0205 (pfs)
Enzymes [BR:cla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     CLA_0205 (pfs)
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     CLA_0205 (pfs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1 SASP
Motif
Other DBs
NCBI-ProteinID: ACM63568
UniProt: B9KET3
LinkDB All DBs
Position
182676..183362
Genome map
AA seq 228 aa AA seqDB search
MKIAILGAMPEEVTPLLETLKEYQTIEYANNTYYLAKYKNHELIIAYSKIGKVNSTLSAT
IMIEKFKAELLLFTGVAGAFNPNLDIGDLIYATKLAQYDLDITAFGHPLGYVPGNEIFIK
TDDKLNNLAIEVAKELGVKLQSGIIATGDEFICDENKKTKIREIFNADACEMEGASVALV
CDALKIPCLILRSMSDKAGEKAEFDFDEFVEKSAKISANFVLKICEKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagccattttaggagctatgcctgaagaggttactcctttattagaaacatta
aaagagtatcaaacaatcgaatatgcaaataatacttattatcttgcaaaatataaaaat
catgaattaattatcgcttattctaagatagggaaagtaaattctacccttagtgcgact
attatgatagaaaaatttaaagctgaacttttactctttacaggtgtagctggtgctttt
aatccaaatttagatataggtgatttaatctatgctacaaaattagctcaatatgattta
gatatcactgcttttggtcatcctcttggctatgttcctggtaatgaaatttttataaaa
acagacgataagcttaataatcttgctatagaagttgctaaagaacttggtgttaaatta
caatcaggtattatcgctacaggtgatgagtttatttgtgatgagaataaaaaaacaaaa
attagagaaatttttaatgctgatgcttgtgaaatggaaggagctagtgtagctttggta
tgtgatgctttaaaaattccatgcttaattttaagatcaatgagtgataaagcaggtgag
aaagctgaatttgactttgatgaatttgttgaaaaatcagctaaaatttcagctaatttt
gtcttaaaaatttgtgagaaattatga

DBGET integrated database retrieval system