KEGG   Cedecea lapagei: NCTC11466_00109Help
Entry
NCTC11466_00109   CDS       T05810                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
clap  Cedecea lapagei
Pathway
clap00250  Alanine, aspartate and glutamate metabolism
clap00410  beta-Alanine metabolism
clap00640  Propanoate metabolism
clap00650  Butanoate metabolism
clap01100  Metabolic pathways
clap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:clap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCTC11466_00109 (puuE)
   00650 Butanoate metabolism
    NCTC11466_00109 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCTC11466_00109 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCTC11466_00109 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clap01007]
    NCTC11466_00109 (puuE)
Enzymes [BR:clap01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NCTC11466_00109 (puuE)
Amino acid related enzymes [BR:clap01007]
 Aminotransferase (transaminase)
  Class III
   NCTC11466_00109 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: VEB95021
LinkDB All DBs
Position
1:111148..112413
Genome map
AA seq 421 aa AA seqDB search
MKSAELNQRRLQATPRGVGVMCSYFAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAVEKQLQAFTHTAYQIVPYESYVSLAERINELAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTKRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVTTE
DALKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPPEFMQALRQLCDTHGILLIADEV
QTGFARTGKLFAMEYYDVKADLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIKEEQLCKRATQLGEHLKEVLNQARHSCPAIVDVRGQGSMVAVEFND
PQTGKPSPEFTREVQLKAQEQGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALAILSQVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgcagagctgaatcagcgtcgtttacaggccacgcctcgcggcgtgggcgtt
atgtgtagctactttgcagagaaggctgagaacgccaccctgtgggatgtggagggcaac
gaagttatcgattttgccgccgggattgcggtgctgaacaccggccatcgccatccgaag
gtaattgccgcggtagaaaaacagctgcaggcctttacccataccgcctatcagattgtc
ccctatgaaagctacgtttcgctggcagagcgcatcaacgagctggcgcccatcgatggc
ccggctaagacggcgttctttactacgggtgcagaagccgttgagaatgctgtaaaaatt
gctcgtgcctacaccaaacgtcctggcctgatcaccttcggcggtggtttccatggccgt
acctttatgaccatggcgctgaccggcaaagtggcgccttacaaaatcggtttcggcccc
ttcccgggctccgtttaccacgcggtttacccgaatgccgcgcacggcgtcaccactgaa
gatgcgttgaaaagcctggagcgtatctttaaagcggatatcgctgccgatcaggttgcg
gccatcgtgctggagccgattcagggcgaaggcggctttaacgttgcgccacctgaattt
atgcaggcgctgcgccagctgtgcgacacccacggcattctgctgattgccgatgaagtg
cagaccggcttcgcacgcaccggcaagctgttcgccatggagtattacgacgttaaagcc
gacctgatgacgatggcgaaaagcctggccggtggtttcccgctctccggcgttgtcggc
cgcgctgaagtgatggatgcgcctgcgcccggtggcctgggcggtacttatgcgggcaac
ccgctggcggttgctgcggctcatgcggtgctggatgttattaaagaagagcagctgtgc
aagcgcgcaacccagcttggcgaacatctgaaagaggtgctgaaccaggctcgtcacagc
tgcccggccattgtggacgtgcgcgggcaaggttcgatggtggcggtggagtttaacgat
ccgcagaccgggaagccttcaccggaattcacccgagaagttcagctaaaggctcaggag
caggggcttttgctgcttagctgcggcgtttacggcaacgttattcgcttcctgtacccg
ctgactatccccgatgctcagttcaccaaagcgctggctatcctgtcccaggtgcttaag
agctga

DBGET integrated database retrieval system