KEGG   Cedecea lapagei: NCTC11466_01130Help
Entry
NCTC11466_01130   CDS       T05810                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
clap  Cedecea lapagei
Brite
KEGG Orthology (KO) [BR:clap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC11466_01130 (ahpF)
Enzymes [BR:clap01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC11466_01130 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored FAD_binding_3 DAO K_oxygenase Thi4 AlaDh_PNT_C NAD_binding_8 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: VEB95990
UniProt: A0A447UZ73
LinkDB All DBs
Position
1:complement(1141395..1142963)
Genome map
AA seq 522 aa AA seqDB search
MLDTTMKTQLKAYLERLTKPVELIATLDDGAKSSEVKELLAEIAELSDKVSFTVNNDLPV
RKPSFLITNPGSSQGPRFAGSPLGHEFTSLVLALLQVGGHPSKESQDLLAQIREIDGDFH
FETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGGVYQNEIQERNVMGVPAVYLNGKE
FGQGRMTLAEIVGKIDTGAEKRAAEALNQREAYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSASKLIPAKSEG
GLHQIQTASGATLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKVRSLKNVDIVLNAQTLEVKGD
GSKVTGLQYKDRVTESVHDVALSGIFVQIGLLPNTNWLEGSVERNRMGEIIIDAKCETTV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTSAPE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaacaatgaaaacccagctcaaagcctatcttgagagactaacgaaacct
gttgagttgattgccacgctggacgacggcgcgaaatcatctgaagtaaaagaactgctg
gcggagatcgctgagttatctgacaaagtttctttcaccgttaataacgacctgccggtg
cgcaagccgtcgtttttaatcactaacccaggctcaagccagggcccgcgctttgccggc
tctccgctgggtcacgaattcacttccctggtgctggcattgctccaggtcggcggtcat
ccgtccaaagagtctcaggatctgctggcgcaaatccgtgagatcgacggcgacttccac
tttgaaacctattactccctctcctgccacaactgcccggacgttgtgcaggcgctgaac
ctgatgagcgtgctgaacccgcgcatcacccataccgctatcgacggcggcgtttaccag
aatgaaattcaggaacgcaacgtgatgggcgtgccagccgtctacctgaacggcaaagag
tttggccagggccgcatgacccttgccgaaatcgtcggcaaaattgataccggcgcggaa
aaacgcgcggcggaagcgctgaaccagcgtgaagcttacgacgtgctgatcgtcggcagc
ggccctgcgggcgcggcggcggcggtttatgcggcgcgtaaaggcatccgcaccggcctg
atgggcgagcgcttcggcggccaggtgctggataccgtggatatcgagaactacatttcc
gtgccaaaaaccgaaggccagaagctggcgggggcgctgaaagcccacgttgacgattac
gacgtggacgttatcgatacccaaagcgccagcaagctgatcccggcgaaaagcgaaggc
ggcctgcaccagatccaaacggcgtccggcgcaacgctcaaagcccgcagcattatcgtg
gccaccggcgcaaaatggcgcaacatgaacgtgcctggcgaagaccagtaccgcaccaaa
ggcgtgacctactgtccgcactgcgacggcccgctgtttaaaggcaagcgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggctattgacctggcgggcatcgtcgagcac
gtgaccctgctggaatttgccccggaaatgaaggccgaccaggtgctgcagaacaaagtt
cgcagcctgaaaaacgtcgatatcgtgcttaacgcccagacgctggaagtgaaaggcgac
ggcagcaaagtgaccggcctgcagtacaaagatcgcgttaccgagagcgtgcatgacgtt
gccctgtccggcatcttcgtgcaaatcggcctgctgccgaacactaactggctggaaggc
agcgtggagcgcaaccgcatgggtgaaatcatcatcgatgcgaaatgtgagaccaccgtg
aagggcgtattcgccgcgggcgactgcaccaccgtgccttacaaacagatcatcatcgcg
accggcgaaggcgctaaagcttccctgagcgcgtttgattacctgattcgcacttcagca
cctgaataa

DBGET integrated database retrieval system