KEGG   Cedecea lapagei: NCTC11466_01882Help
Entry
NCTC11466_01882   CDS       T05810                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
clap  Cedecea lapagei
Pathway
clap00061  Fatty acid biosynthesis
clap00780  Biotin metabolism
clap01100  Metabolic pathways
clap01130  Biosynthesis of antibiotics
clap01212  Fatty acid metabolism
Module
clap_M00083  Fatty acid biosynthesis, elongation
clap_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:clap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC11466_01882 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC11466_01882 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NCTC11466_01882 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:clap01004]
    NCTC11466_01882 (fabI)
Enzymes [BR:clap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NCTC11466_01882 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NCTC11466_01882 (fabI)
Lipid biosynthesis proteins [BR:clap01004]
 Fatty acid synthase
  Component type
   NCTC11466_01882 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: VEB96907
UniProt: A0A3S4IDL2
LinkDB All DBs
Position
1:1896165..1896956
Genome map
AA seq 263 aa AA seqDB search
MGFLTGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNEKLKGRVEGFAAELGSSIV
LPCDVAEDESIEALFTELAKSWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
AYSFVAMAKVCREMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELKD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttaccggtaaacgcattctgatcactggcgtcgccagtaaactctccatt
gcctacggtatcgcacaggcgatgcaccgcgaaggtgccgagctggctttcacctaccag
aacgagaagctgaaaggccgtgtggaaggttttgctgccgagctgggctcaagcatcgtg
ctgccttgcgatgtggctgaagatgagagcatcgaagcgctgtttaccgaactggcgaaa
agctggccgaaatttgacggtttcgttcactccatcggcttcgcccctggcgaccagctg
gatggcgactatgtgaacgccgtgacccgtgaaggctttaaaattgcccacgacatcagt
gcctacagcttcgtggcaatggcaaaagtgtgccgcgaaatgctgaacccaggctccgcc
ctgctgaccctctcctacctgggcgcagagcgtgctatccctaactacaacgttatgggc
ctggcaaaagcgtctctggaagccaacgttcgctacatggctaacgcgatggggcctgaa
ggcgtgcgcgtaaacgctatctccgcaggtccaatccgtaccctggctgcctccggcatc
aaagacttccgtaaaatgctggcccactgcgaagcggtaaccccaattcgtcgtaccgtg
accattgaagatgtgggtaactccgcagccttcctgtgttccgacctctccgccgggatc
tccggtgaagtggttcacgttgacggcggcttcagcatcgctgcaatgaacgagctggaa
ctgaaagactaa

DBGET integrated database retrieval system