KEGG   Cedecea lapagei: NCTC11466_02507
Entry
NCTC11466_02507   CDS       T05810                                 

Definition
(GenBank) Uncharacterized protein conserved in bacteria
  KO
K11900  type VI secretion system protein ImpC
Organism
clap  Cedecea lapagei
Brite
KEGG Orthology (KO) [BR:clap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:clap02044]
    NCTC11466_02507
Secretion system [BR:clap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCTC11466_02507
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: VEB98121
UniProt: A0A447V2Y6
LinkDB
Position
1:complement(2550667..2552208)
AA seq 513 aa
MSVKNENAASGENVVLERPEAGGVYASLFEKINLNPVSELSALDIWQDAQAMSDATADER
LTAGMQVFLECLSKAGSKVDKLDKSLIDHHIAALDHQISRQLDAVMHHEDFQAVESLWRG
VKSLVDKTDFRQNVKIELLDLSKEDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAA
LVSAYEFDASAQDVALLRNISKVSAAAHMPFIGSAGPQFFLKDSMEEVAAIKDIGNYFDR
AEYIKWKSFRDTDDSRYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHDKYLWTNA
SFAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPSEVMIPETREF
EFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINSRLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNP
GFFRVKLFAVPHFQVEGMDVNLSLVSQMPKAKS
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtctgtaaaaaatgaaaatgccgccagcggcgaaaatgtggtgctggagcgcccggaa
gcgggcggcgtgtacgcgtccctgtttgaaaaaattaacctgaacccggtctctgagctg
agcgcgctggatatctggcaggatgcgcaggcgatgtcggatgcgaccgccgacgagcgc
ctgaccgccggaatgcaggtgtttctggagtgtctgagcaaggcgggttcaaaagtcgat
aaactcgacaaatccctgattgaccaccatatcgcggcgcttgaccaccagatcagccgc
cagctggatgcggtgatgcatcatgaggactttcaggcggtagaaagcctgtggcgcggc
gtgaaatccctggtggataaaaccgacttccgccagaacgtcaaaatcgagctgctggac
ctctccaaagaggatctgcgtcaggacttcgaggacgcgccggaaatcatccagagcggg
ctgtacctgcagacgtatgtggctgaatacgacaccccgggtggcgagccgattgccgct
ctggtctcggcttacgagttcgatgcctctgcgcaggacgtagcgctgctgcgtaatatc
tccaaagtgtctgccgccgcgcatatgccgtttatcggctccgctggtccgcagttcttc
ctgaaagattctatggaagaggttgcggccatcaaggatatcggcaactactttgaccgc
gcagaatacatcaagtggaaatccttccgcgacaccgatgacagccgctatatcggtctg
gtgatgccgcgtgtactggggcgtctgccttacggcccggacacggtaccggtgcgcagc
ttcaactacgtcgaagaggtgaaaggcccggaccacgataaatacctgtggaccaacgcg
tcgtttgcgtttgcctccaacatggtgcgcagctttatcaacaacggctggtgcgtacag
atccgtggcccgcaggctggcggtgcagtacaggatttaccgatccacctgtatgacctg
ggaaccggcaaccaggtgaagatcccgagtgaagtgatgatcccggaaacccgcgagttt
gagttcgccaacctcggttttattccgctgtcgtattacaaaaaccgcgattacgcctgc
ttcttctccgctaactctacccaaaaaccggcgctgtacgacaccgcggacgccacggcc
aacagccgtatcaactcccgcctgccgtatatcttcctgctgtcccgtatcgcccattat
ctgaagctgattcagcgtgaaaacatcggcaccaccaaggatcgccgtctgctggagctg
gagctcaacacctgggttcgcagcctggtgaccgagatgaccgatcctggcgacgagctg
caggcgtcacacccgctgcgtgacgcaaaagtggtggtagaagatatcgaagataacccg
ggcttcttccgcgtaaaactgtttgctgtaccgcatttccaggtcgaaggcatggacgtc
aacctgtcgctggtttcccagatgccgaaggcgaaatcgtaa

DBGET integrated database retrieval system