KEGG   Cedecea lapagei: NCTC11466_03628
Entry
NCTC11466_03628   CDS       T05810                                 

Gene name
yiaD
Definition
(GenBank) Inner membrane lipoprotein YiaD precursor
  KO
K11892  type VI secretion system protein ImpK
Organism
clap  Cedecea lapagei
Pathway
clap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:clap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCTC11466_03628 (yiaD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:clap02044]
    NCTC11466_03628 (yiaD)
Secretion system [BR:clap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCTC11466_03628 (yiaD)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: VEC00432
UniProt: A0A447V686
LinkDB
Position
1:complement(3616803..3618164)
AA seq 453 aa
MKDEINQNTTPGATQEEDTSPQALGRFLLDEQGDWIQEPEATPTAQPHASGSGERTAGND
RTLRSESVQQRMIKVSAAENPLLEAAQPLLRALSDMPEQIGDLAHVEILKNTLKSQINLF
GIVCDEVNIPWKKMAIVRYCLCTALDEAAHTAPWGLEAGWSQSNLLNHFEGDNDGGNKFF
LLIGRLSMNPSEFADVLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQRLLTLIQSTRNTT
QPILSPHGLQPQGPVRHERLVVPVRITALCAGILVASAFIWCKYSLLVNSTRITSNINAM
KNIKVSVPQVKMRLRLSILLRNEIQRQLLSVDETQKQSKVVLKGDSLFLSGSTRVQPEMV
KVIERVAREVRRVNGDIVIVGHTDATPISRPGLPNNVVLSEKRAAEVARYFIEAGVPESK
VKVEGVGSSQPLASDATAQGRAKNRRVEFFVTY
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaaagacgagattaatcagaacacaacgcctggcgccacgcaggaggaggacacttct
cctcaggcgctggggcggtttcttcttgatgagcagggagactggatccaggagccggag
gccaccccgacggctcaacctcacgcatccggcagcggcgagcgaacggccgggaacgat
cggacgttaagaagcgaaagcgtccagcagcgcatgatcaaagtcagcgccgctgagaac
ccgctgcttgaggccgcccagccgctgctgcgtgcgctcagcgatatgccagagcagatc
ggcgatctggcgcacgttgagatcctgaaaaacacgcttaagagccagattaatctcttc
ggcatcgtctgcgatgaagtgaatatcccgtggaaaaaaatggcgattgttcgctattgc
ctgtgtaccgcgcttgatgaagcggcacataccgcgccgtgggggcttgaagccggctgg
tctcagagcaacctgctgaaccattttgaaggggataacgacggcgggaataagttcttc
ctgcttattggccgtctgtcgatgaacccgagcgagtttgccgacgtcctggaagtgctg
ctgcgtatccttggcctcggctttgaggggcgttacagcatcattgaagacggcgatcgc
cagctcaccaagatccgccagcgcctgctgacgttaatccaaagcacgcgcaataccact
cagccgatcctgtcgccgcacgggcttcagccccaggggccggttcgccatgaaaggctg
gtggtgcccgtcaggatcaccgcgctttgcgccggcattctggtggcctctgcctttatc
tggtgtaagtactctctgctggtgaatagcacaagaattaccagcaatatcaatgcgatg
aaaaacattaaggtcagcgtgccgcaggtgaaaatgcgcctcagattgagcattttactc
cgcaacgaaattcagcggcagctgctcagcgtggatgaaacgcaaaagcaaagcaaagtc
gtgctgaaaggcgactccctgttcttgtccggctcaacccgggttcagccggagatggtc
aaggtcattgagcgagtggcccgtgaagtccgtcgcgttaacggcgatatcgtgattgtc
ggccataccgacgccacgccgatcagccgaccgggcttgcctaacaacgtggtgctttct
gaaaaacgagccgccgaagtggcccgctatttcattgaggcgggcgtaccggagagcaag
gtgaaagtcgaaggggtggggagcagccagccgctggcctccgatgctaccgctcaggga
cgggcgaagaatcgccgcgtagagttttttgtcacgtattaa

DBGET integrated database retrieval system