KEGG   Cedecea lapagei: NCTC11466_03633
Entry
NCTC11466_03633   CDS       T05810                                 

Definition
(GenBank) Uncharacterized protein conserved in bacteria
  KO
K11901  type VI secretion system protein ImpB
Organism
clap  Cedecea lapagei
Brite
KEGG Orthology (KO) [BR:clap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:clap02044]
    NCTC11466_03633
Secretion system [BR:clap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCTC11466_03633
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: VEC00442
UniProt: A0A3S4IQE5
LinkDB
Position
1:complement(3622402..3622926)
AA seq 174 aa
MSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMGVLADLSGKPLEPLPPVADRK
FLSIDIDNFDERMKAMRPRVAFAVPNTLTGEGQLMVDMTFDSMDDFAPDAIARKVDSLSQ
LLEARTQLANLQTYMDGKAGAESLVMKVLNDKSLLNTLASSPKPKQADEATSQK
NT seq 525 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaattcgcaaaaattcatcgcacgtaaccgtgcgccgcgcgtgcagatc
gagtacgacgtggaaatttatggcagtgaaaagaaaattgagctgccgtttgtcatgggc
gtactggccgatctgtccggtaagccgcttgagccgctgccgcctgtcgccgacaggaaa
ttcctcagcatcgatatcgataacttcgacgagcgcatgaaagctatgcgtccgcgcgtc
gcgttcgctgtccctaacaccctgacgggcgaagggcagctgatggtcgatatgaccttc
gacagcatggacgatttcgcgccggatgcgattgcccgcaaggtggattccttatcgcag
ctgctggaggcgagaacccagcttgccaacctgcagacctatatggacggtaaagccggg
gcggaaagtctggtgatgaaagtgctgaacgataagtcgctgctgaacacgctggcttcg
tcgccaaagccaaaacaggctgatgaagccacgtcccaaaagtga

DBGET integrated database retrieval system