KEGG   Cedecea lapagei: NCTC11466_04383Help
Entry
NCTC11466_04383   CDS       T05810                                 

Gene name
fadB
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
clap  Cedecea lapagei
Pathway
clap00071  Fatty acid degradation
clap00280  Valine, leucine and isoleucine degradation
clap00281  Geraniol degradation
clap00310  Lysine degradation
clap00362  Benzoate degradation
clap00380  Tryptophan metabolism
clap00410  beta-Alanine metabolism
clap00640  Propanoate metabolism
clap00650  Butanoate metabolism
clap00903  Limonene and pinene degradation
clap00930  Caprolactam degradation
clap01100  Metabolic pathways
clap01110  Biosynthesis of secondary metabolites
clap01120  Microbial metabolism in diverse environments
clap01130  Biosynthesis of antibiotics
clap01200  Carbon metabolism
clap01212  Fatty acid metabolism
Module
clap_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:clap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCTC11466_04383 (fadB)
   00650 Butanoate metabolism
    NCTC11466_04383 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCTC11466_04383 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCTC11466_04383 (fadB)
   00310 Lysine degradation
    NCTC11466_04383 (fadB)
   00380 Tryptophan metabolism
    NCTC11466_04383 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCTC11466_04383 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NCTC11466_04383 (fadB)
   00281 Geraniol degradation
    NCTC11466_04383 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCTC11466_04383 (fadB)
   00930 Caprolactam degradation
    NCTC11466_04383 (fadB)
Enzymes [BR:clap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NCTC11466_04383 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NCTC11466_04383 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NCTC11466_04383 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     NCTC11466_04383 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: VEC01698
UniProt: A0A3S4MIS2
LinkDB All DBs
Position
1:4399747..4401936
Genome map
AA seq 729 aa AA seqDB search
MLYQGETLHLDWLEDGIAELVFDAPGSVNKLDTATVASLGEALAVLEKQPNLKGLLLSSS
KSAFIVGADITEFLSLFLVPAEQLTHWLQFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATADARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIITAGKDVSAAEAQK
LGLVDGVVKTEKLRDGALAILRQAIKGELDWQAKRAPKLQPLKLSKIEAGMSFTIAKGMV
AQIAGKHYPAPMTAVKTIEAAAGLGRDEALKLETQSFVPLARSNEARALVGIFLNDQFVK
GKAKKLTKDIETPEHAAVLGAGIMGGGIAYQSAWKGVPVLMKDINEKSLALGINEASKLL
NKQLERGKIDGMKLAQVISTIQPTLEYAGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DAVLASNTSTIPISELANVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDVTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMSKDYRDAIDVLFDAGRYGQKTQQGFYRFKEDKKGKP
RKEQDEAVDGLLAEVSQPKRSFSDEEIIARMMIPMVNEVVRCLEEGVIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYFDMAQQYQNLGPLYAVPEGLKAKASRNEPYYPPVEPA
RPASDLKSA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggtgaaaccctacatctcgactggctggaagacggcatcgccgaactg
gtgtttgatgcccccggctccgtcaacaagctggatacggcgaccgttgccagcctcggc
gaagcgctggccgtgcttgaaaaacagcccaatctcaaaggcctgctgctgagctcgagc
aagtccgcctttatcgttggcgccgacattaccgaattcctgtcgctgttcctggtgccc
gctgaacagctgacccattggctgcagtttgccaacagcgtatttaaccgcctggaagat
ctgcctgtcccgaccatcgccgccgtgaatggctatgcgctgggtggtggatgcgaatgc
gtactggcgacggattaccggttggcgacagcggatgcccgcattggcctgccggaaacc
aaattaggcatcatgcccggcttcggcggttccgttcgcctgcctcgcctgttgggtgcc
gatagcgcgcttgaaattattaccgcgggcaaagatgtcagcgcagcagaagcgcaaaaa
ctggggctggttgatggcgtagtaaaaaccgaaaagctgcgcgacggtgcgctggcgatt
ctgcgccaggcaatcaaaggcgagctggactggcaggctaaacgcgcgccgaaactgcag
cctctgaaactgagcaaaattgaagccggcatgagctttaccatcgccaaaggcatggtg
gcacagatcgccggcaagcattatccagccccgatgaccgcggtaaaaacgattgaagcc
gccgcaggccttggccgcgatgaagccctgaagcttgagacccaaagctttgtgccgctg
gctcgctccaatgaagcccgcgcgctggtcggcatctttttgaacgatcagttcgttaaa
ggcaaagcgaaaaagctcaccaaagatatcgaaacgcctgaacacgcagccgtgctgggc
gcaggcattatgggcggcggcattgcttaccagtcagcctggaaaggcgtgccggtatta
atgaaggacatcaacgagaagtcgctggcattaggtattaatgaagccagcaagctgctg
aacaagcagcttgagcgcggcaaaattgacggcatgaaactggctcaggttatctcaacc
attcagccgacgctggaatatgccgggtttgagcgcgtagacgtcgttgtggaagccgtt
gttgagaacccaaaagtgaaaaaggcggtgctggcagaaaccgaagacaaggttcgcccg
gatgccgtcctggcttccaacacctccaccattcctatcagcgagctggcaaacgtgctt
aaacgcccggaaaacttctgcggcatgcacttctttaacccggttcaccgcatgccgctg
gttgaagtcattcgcggagaaaaaacctcggacgtcactattgccaaagtggtggcgtgg
gcgagcaagatgggcaaaacgcctatcgtggtgaacgactgcccgggcttctttgtaaac
cgcgtgctcttcccctacttcgcaggctttagccagctgctgcgcgacggcgctgatttc
cgccagattgataaagtgatggaaaaacagttcggctggccgatgggcccggcttatctg
ctggatgtggtcgggattgataccgctcatcacgcccaggcggtaatggccgccggcttc
ccacagcgtatgagcaaagattaccgcgacgctatcgacgttcttttcgatgccggacgc
tacggccagaaaacccagcagggcttctaccgctttaaagaagacaaaaaaggtaaaccg
cgcaaagagcaggacgaggctgtcgacggcctgctggcagaagttagccagcctaagcgc
agcttcagcgacgaagaaattatcgcccgcatgatgatcccgatggtcaacgaagtcgtt
cgctgcctcgaagaaggcgtgattgccagcccggcagaagccgacatggcgctggtttac
ggcctcggtttccctccgttccacggcggtgcattccgctggctggacaccctgggcagc
gcgaaatatttcgatatggcgcagcagtaccaaaacctcggcccgctgtatgccgtgcct
gaaggcctgaaggccaaagcatcacgcaatgagccgtactatccgccggttgagcctgcc
cgcccggccagtgacctgaaaagcgcctga

DBGET integrated database retrieval system