KEGG   Clostridium sp. BNL1100: Clo1100_2617Help
Entry
Clo1100_2617      CDS       T01708                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00040  Pentose and glucuronate interconversions
clb00051  Fructose and mannose metabolism
clb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clo1100_2617
   00051 Fructose and mannose metabolism
    Clo1100_2617
Enzymes [BR:clb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Clo1100_2617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP AlaDh_PNT_C NAD_binding_3 Ldh_1_N DapB_N TrkA_N ThiF DAO
Motif
Other DBs
NCBI-ProteinID: AEY66782
UniProt: H2JGL9
LinkDB All DBs
Position
complement(2970575..2971615)
Genome map
AA seq 346 aa AA seqDB search
MKNRAAYMTGINKMEIRDIEVPKLREKDVLVKLEYVGICGSDVHYLEHGKIGDFIVNGDF
ILGHECAGTVVEVGSGVQNLKVGDKVALEPGITCGQCEFCKTGRYNLCPDVEFLATPPYH
GSLMNYIAFPENMCFKLPDNITTKEGALVEPLAVGMHSANQGNVKLGSSVVILGAGTIGL
VTLLACKANGATDITVVDVIPKRLEYAKNLGATNTINAAEVDVFAEIDKLTDKKGVDVVI
ETAGSARTISQTPYLVKNGGTIVLVGLAPQDIIEFNFAKIMAKEATIKSVFRYKNIYPIA
IKAISKGIIDITGIVTHEFDFDDVAHAFDYVINNKQDVVKAVIKID
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagagcggcttatatgaccggaataaacaaaatggagataagggatatagag
gttccaaagctcagagaaaaggatgtacttgtaaagcttgagtatgtgggaatttgcggt
tctgacgtgcattatcttgagcatggaaaaatcggtgattttatagtaaatggagatttc
atacttggacatgaatgtgccggaacagttgttgaagttggcagcggagtacaaaaccta
aaagtaggagataaggttgccttagaaccgggaataacttgcggacaatgcgaattctgt
aaaacaggaagatataatctttgcccggatgttgaatttttagcaacaccgccttaccac
ggttcattaatgaattatatcgctttcccggaaaatatgtgctttaaactgcctgataac
ataacaacaaaagagggagcattagttgaacctttggctgttggtatgcactcagcaaac
cagggaaatgtaaagcttggaagctcagttgttattcttggagcaggaacaataggactt
gttacattgcttgcatgtaaagcaaacggagcaactgacattactgtagttgacgtaata
ccaaagagactggaatatgcaaaaaatctgggagcaaccaatacaataaatgcagcagaa
gttgatgtgttcgcagaaatagacaaactcaccgataaaaagggagtagacgttgttata
gagactgccggttcagcaagaactatttcacagactccttaccttgttaaaaacggcggt
accattgttcttgtaggtttggctccacaggatataattgaattcaactttgcaaagatt
atggcaaaggaagctacaattaaatccgttttccgttacaaaaacatatatcctatagct
ataaaggctatttcaaaaggaatcatagatataacaggaatagtaacacatgaatttgat
tttgatgatgttgcacatgcttttgactatgtaataaacaataagcaggatgttgttaag
gcagttatcaaaatagactaa

DBGET integrated database retrieval system