KEGG   Clostridium sp. BNL1100: Clo1100_2651Help
Entry
Clo1100_2651      CDS       T01708                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00500  Starch and sucrose metabolism
clb01100  Metabolic pathways
clb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clo1100_2651
Enzymes [BR:clb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Clo1100_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AEY66813
UniProt: H2JGQ0
LinkDB All DBs
Position
3021720..3024281
Genome map
AA seq 853 aa AA seqDB search
MYLVGKINVISTLPEKFKRLNDIAYNLWWTWNSEAIDLYREIDLELWEKVDKNPVRFLQE
VSQKKLQAKLSDEEYLSRLDKVVASFDSYMSEKNTWFSQNHPEHTDKMVAYFSAEYGLSE
VLPIYSGGLGVLSGDHCKSASDLGIPFTAIGLFYKQGYFSQRINKDGWQETCFNDLNISQ
LPMQPALNSNGEQVRINITFAGRTVYAIVWKVQIGRINLYLMDTDVAENSPADRSLTSRL
YGGDQETRIQQEIFLGIGGIRVLDALSIQANVYHMNEGHSSFMGLELIRKLINEKHLNFN
EAMEVVANSTIFTTHTPVPAGNDVFPLFMMDKYFGDFWGQLGLSRYDFLELGLKKPEDQN
FNMTVLALTLAGRKNGVSRLHGAVSRKIFGDVWPEVPEDDVPITYVTNGIHTLTWLSPKI
KALYDKYLERDWQKKIYSQETFTNVNSIPDEELWATHVELKNKLITFIRDRLKKQKLANG
ESMEAVRQVDSFLDPNVLTIGFARRFATYKRANLIFRNLARIQKILNDPERPMQIIFAGK
AHPADGPAHDVIKNINDIAKMEGFYGKVILLENYNMTVARNLVQGVDVWMNNPRRPLEAS
GTSGQKVCINGVINFSILDGWWCEGYNGENGWVIGDESEFDNEHIQDNTDSESIYDTLEH
KIIPLFYNVNEKGVPTEWVRIMKNSISSLAWNYSTDRMVKEYTGSMYVPAITGSSKICTD
NYSLARSMCEFRSHLNSNWPNVQLFAEKSAGDLKYYKTDSCQEIYLSSTVCLGYIDPSNV
TVEVYYGTLSNGKIENAQSAQMHCDEKTGEGTYRYSINLKIYDGGEYGYTFRITPKHEYL
INRFDTGLIKWIV
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgtatctagtcggtaaaatcaacgtaatatctaccttaccagaaaaattcaagagattg
aatgacatcgcttataatttatggtggacatggaattcggaggcaattgacctttataga
gaaattgatttggagctgtgggaaaaggttgacaaaaaccctgtccgttttttacaggag
gtaagtcagaaaaaacttcaagctaaactttcggatgaagaatatttgagccgtcttgat
aaagtagttgcttcctttgacagctatatgtctgaaaagaatacatggttttctcaaaat
catccggaacataccgataaaatggtagcatatttttcagccgaatatgggttaagtgaa
gtccttcccatatattccggcggtttaggtgttttgtcaggagaccattgcaagtcggca
agtgatttgggtataccatttacagcaatcggactgttttataaacaaggttacttcagc
cagagaatcaataaagacggctggcaggagacctgctttaacgatttaaatatatctcag
cttcccatgcagcccgctcttaattccaacggcgaacaggttcgtataaacataaccttt
gcaggccgtactgtgtatgcaatcgtttggaaagtacagattggcaggataaacctttat
cttatggatacagatgttgctgaaaacagccctgcagacaggtcactgacatccagactg
tatggtggagaccaggaaacaagaattcagcaggagatttttctcggtataggcggtata
cgtgtacttgatgctcttagcatacaggcaaatgtatatcatatgaacgaaggacattca
tccttcatggggcttgaacttataagaaaacttattaatgaaaaacatctgaatttcaac
gaggcaatggaggtagtggcaaattccacaatatttactacccataccccggttcctgca
ggaaatgatgtttttcctttatttatgatggataaatactttggagatttctgggggcag
cttggccttagcagatatgattttcttgaactgggtctgaaaaaaccggaagaccagaat
tttaacatgactgttctggcccttacccttgcaggtaggaaaaatggtgtaagcagactt
catggtgcagtatccagaaaaatattcggtgacgtatggcctgaagtacctgaggatgat
gttccaataacctatgttacaaatggaatacatacccttacgtggctttcaccaaaaatt
aaagctttgtatgataaatatctggaaagagactggcaaaagaaaatttattctcaagaa
acctttaccaatgttaatagtattcccgacgaggaattatgggctactcatgttgaactt
aaaaacaagcttataacctttataagagacagattgaagaaacaaaagcttgccaacgga
gaatccatggaagctgtaaggcaagtggacagctttttggatccaaacgtacttacgatt
ggttttgccagaagatttgctacctacaagcgtgccaatctgattttcagaaatctggca
agaatacagaagatactaaatgacccggaaaggccaatgcagattatttttgcgggaaaa
gctcatcctgcggacggtcctgcccatgatgttattaagaacataaatgatattgctaaa
atggaaggcttttacggcaaagtaatccttcttgaaaactacaatatgacggtagccaga
aatctggtgcaaggtgttgacgtttggatgaacaaccccagaaggccccttgaagccagc
ggtaccagcggtcaaaaagtttgtataaacggagttataaacttcagtatactggacggc
tggtggtgtgagggttacaacggtgaaaacggttgggtaattggcgatgaatccgaattt
gacaatgagcacatacaggacaatacagacagtgaatctatttacgatacacttgagcat
aagattataccgcttttttacaatgtaaatgaaaaaggtgttcctaccgaatgggtacga
attatgaagaactctataagttctcttgcatggaattacagtaccgacagaatggtaaag
gaatataccggaagtatgtatgtgccggcaataacaggaagttcaaaaatatgtaccgat
aattacagtcttgcaaggtcaatgtgtgagtttaggagccatttaaattcaaactggcct
aacgtacagctctttgcagaaaaatcagccggagaccttaaatattacaaaactgattcc
tgtcaggaaatatatctctcatcaaccgtttgccttggttatatagacccatcaaacgta
actgttgaggtatactatggtacactatcaaacggaaaaatagaaaatgctcaatcagca
caaatgcactgtgacgaaaaaacaggtgaaggtacctacaggtattcgattaatcttaaa
atctatgatggaggagaatatggctataccttccgtataacaccaaaacatgaatattta
ataaacagatttgataccgggctgataaaatggattgtataa

DBGET integrated database retrieval system