KEGG   Clostridium sp. BNL1100: Clo1100_3695Help
Entry
Clo1100_3695      CDS       T01708                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00473  D-Alanine metabolism
clb01100  Metabolic pathways
clb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:clb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clo1100_3695
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Clo1100_3695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:clb01011]
    Clo1100_3695
Enzymes [BR:clb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Clo1100_3695
Peptidoglycan biosynthesis and degradation proteins [BR:clb01011]
 Precursor biosynthesis
  Racemase
   Clo1100_3695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEY67814
UniProt: H2JB08
LinkDB All DBs
Position
complement(4170047..4171216)
Genome map
AA seq 389 aa AA seqDB search
MEYKLNRAWAEISLDNIAHNIREIRKITGKNAEIMGVVKADAYGHGVMEVAKTLLENGAS
RFAVSMLDEAIQLRRAGIEVPILILGFTDPIRASEIIENDVTQSVFSHDLAQALSDEAVR
QGKKVKIHIKIDTGMSRIGFLPGYSAVKNVVEISRLPNIIIEGLFTHFATADEKNREYTY
TQFERFMSICCELQRIGIHIPVKHCANSAAIIEYPEMHLDMVRPGIILYGMYPSDEVDKS
KIDLKPAMTLKANVIMVKEVEKNTSISYGRIFTTGRTSKIATIPIGYADGFNRMLSNKGK
VLIHGEFAPVVGRICMDQCMVDITDIGCNVEVGDEIVLIGSQGQNNITAEDVAHTIGMIN
YELVCIVGKRIPRAFVKDGKISKILNYLI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaaacttaacagggcatgggctgaaataagccttgataatattgcacacaat
attagagaaataaggaaaattaccggcaaaaatgctgagataatgggagtagtcaaggca
gacgcttatggacacggagtaatggaggtggcaaaaaccctacttgagaatggggcatca
cggtttgcagtatcaatgctggatgaggcaatacagttaaggagagcaggtatagaggtt
cctatacttattcttggatttactgatcctataagagccagtgaaataatagaaaatgat
gtgacacagtcggtattcagccatgatttggcgcaggccttatccgatgaagcagtgagg
cagggcaaaaaggtaaaaatccacataaagattgataccggaatgtccagaataggattt
ctgcctgggtacagcgcggttaaaaacgttgttgaaataagccgtctccccaatatcata
attgaagggctgtttacacattttgctactgccgatgaaaaaaacagggaatacacctat
actcagtttgaaaggtttatgagtatttgctgtgagcttcagcgaataggtatacatatt
ccggttaagcactgtgcaaatagtgcggcaatcattgaataccctgagatgcatcttgat
atggtcaggccggggataatactttacggcatgtacccttctgatgaagttgataagtca
aagattgatttaaaaccggctatgacccttaaagcaaatgtaattatggtaaaggaagtc
gaaaaaaacacctccataagctacggcaggatatttacaaccggcagaacttcaaagatt
gctacaatacccatcggttacgctgacggattcaaccgtatgctaagcaataaggggaag
gtacttattcacggtgagtttgcacctgtagtcggaaggatatgtatggaccagtgtatg
gtggatataactgatattggatgtaacgttgaagtaggagatgagattgtattaattggt
tctcagggacaaaataatattacagcagaggatgttgcccacacaatcggtatgattaat
tatgaattggtttgtatagttggtaaaagaattccaagggcttttgtcaaagatggaaag
atatcgaaaatcctgaattatttgatataa

DBGET integrated database retrieval system