KEGG   Caldicellulosiruptor lactoaceticus: Calla_1807Help
Entry
Calla_1807        CDS       T01600                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
clc  Caldicellulosiruptor lactoaceticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEM74389
UniProt: G2PU38
LinkDB All DBs
Position
complement(1893965..1894942)
Genome map
AA seq 325 aa AA seqDB search
MKAAIFYGKRNLKVEDVSLPVLKEGEILVKVEACGICGTDIHIFNGEEGSAKVTPPIVLG
HEFCGTVVETKSQLFNVGDKVSIDPNIYCGVCRFCRSGRPQLCENLTALGVNINGGFAEY
AVVPEKQAIKFDNIDFAEAALAEPLACCLHGLEKIKIFPTDRILIIGFGPIGLIMLELVK
MYGADNIFGYEVDEFRKNVAKDYGVKAIVDEDCSEENFDVVIECAGTKESIEMAFKKLGK
GGRVLVFSVPSPTVATEICPFEMFRKEAHIFWSFVNPFTQKLAIELLQQGKINLKHVITH
KISLDELPEALSKKFENQLKVIVQP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagccatattttatggtaagagaaacttaaaagtagaagatgttagcttgcct
gtactaaaagaaggagaaattttagtcaaggttgaggcgtgcggtatatgcggcactgat
atccatatatttaacggcgaagaagggtctgcaaaggttacaccgccaatagtgttgggt
catgagttttgtggcactgttgttgagacaaaatctcagcttttcaatgtaggagacaag
gtgagcattgaccctaacatctactgtggagtgtgcaggttttgtagaagtggaaggcct
cagctttgcgaaaacttaactgcgcttggtgtgaacataaacggcgggtttgcggagtat
gccgttgtgcccgagaaacaggcgataaaatttgataacatagattttgctgaggcggca
ctggcagaacctcttgcttgctgtcttcatggtcttgagaaaataaaaatttttcccacc
gatagaattttgataataggctttggtcccattggtcttataatgcttgagcttgtaaaa
atgtatggagctgacaacatctttggctatgaagtagatgagtttagaaaaaatgttgct
aaagattatggagttaaagctattgttgatgaagattgcagtgaagagaactttgatgtt
gtaattgagtgtgcagggacaaaagagagtatcgaaatggcgtttaaaaagctgggaaaa
ggtggcagagttttggttttttctgtaccatcaccgaccgtagctactgaaatttgtcca
tttgagatgttcagaaaggaagcacatattttttggtcgtttgtgaacccatttacacaa
aagcttgcaattgaacttttgcaacaagggaagataaacttaaaacatgttatcacacac
aaaatttcacttgatgagctacctgaggcactttcaaaaaagtttgagaatcaactaaaa
gtgattgtccaaccttga

DBGET integrated database retrieval system