KEGG   Clostridium sporogenes: CLSPO_c04860Help
Entry
CLSPO_c04860      CDS       T03905                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cld  Clostridium sporogenes
Pathway
cld00473  D-Alanine metabolism
cld00550  Peptidoglycan biosynthesis
cld01100  Metabolic pathways
cld01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLSPO_c04860 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLSPO_c04860 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CLSPO_c04860 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cld01011]
    CLSPO_c04860 (ddl)
Enzymes [BR:cld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CLSPO_c04860 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:cld01011]
 Precursor biosynthesis
  Amino acid ligase
   CLSPO_c04860 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 GARS_A RimK ATP-grasp ATPgrasp_ST ATP-grasp_4 PB1 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AKC61210
UniProt: A0A1V9I5T8
LinkDB All DBs
Position
538778..539680
Genome map
AA seq 300 aa AA seqDB search
MKIGVIMGGISTEREVSLNSGREVIKYLELLEHEIIPIIIDKKEDVMEKAKGIDFAFLAL
HGEFGEDGTVQSVLETLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADWVNVSSVEN
IDYEAIEKIGYPVFVKPNSGGSSVATNLVKNKEGIKEAVELALKYDKEVMIENYTKGEEI
TCCMLNGKMLPVLAIRPHAEFFDYTAKYADGGSDEVVIELEENLHKKVEEMALACWKELK
CEVYVRVDMIVKEGVPYVLELNTLPGMTKNSLFPKSANAVGISFAELLNLIVKYSLEVER
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggagttataatgggtggaatatctacagagagagaggtttccttgaattct
ggtagagaagttataaaatatttagaacttttagaacatgaaattattcctattattata
gataaaaaagaagatgttatggaaaaagctaagggtatagattttgctttcttagcattg
catggtgagtttggtgaagatggaacagttcaatcagttcttgaaactttagatatacct
tattcaggatgtggtcctttaacaagtgctatatgtatggataaggatatgactaagaaa
atattaaaatatgccaatattaatacagcagattgggtaaatgtatctagtgtagagaat
atagattacgaagctatagaaaaaataggatatccagtgttcgtaaaacctaatagtggt
ggctctagtgtagctactaatttagtaaaaaataaagagggcataaaagaagcagtagag
cttgcattaaaatatgataaagaagttatgatagaaaattatacaaaaggtgaagaaata
acctgctgtatgctaaatggcaaaatgttaccagtattagctataagaccacatgcagaa
ttctttgactatacagcaaaatatgcagatggcggatcggatgaagtggttatagaattg
gaagaaaatcttcataaaaaggtagaggaaatggccttagcttgttggaaagaactaaaa
tgtgaagtatatgtaagggtagatatgatagttaaagagggagtaccttatgtattagaa
ttaaatacattacctggtatgacaaaaaatagtttgtttcctaagagtgctaacgcagta
ggaatatcctttgcagaattattaaatttaatagttaaatattcattagaagtagaaaga
taa

DBGET integrated database retrieval system