KEGG   Clostridium sporogenes: CLSPO_c19090Help
Entry
CLSPO_c19090      CDS       T03905                                 

Gene name
gadB1
Definition
(GenBank) glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cld  Clostridium sporogenes
Pathway
cld00250  Alanine, aspartate and glutamate metabolism
cld00410  beta-Alanine metabolism
cld00430  Taurine and hypotaurine metabolism
cld00650  Butanoate metabolism
cld01100  Metabolic pathways
cld01110  Biosynthesis of secondary metabolites
cld01120  Microbial metabolism in diverse environments
cld02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLSPO_c19090 (gadB1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLSPO_c19090 (gadB1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLSPO_c19090 (gadB1)
   00430 Taurine and hypotaurine metabolism
    CLSPO_c19090 (gadB1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLSPO_c19090 (gadB1)
Enzymes [BR:cld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CLSPO_c19090 (gadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AKC62629
UniProt: A0A1V9ICZ2
LinkDB All DBs
Position
2111732..2113135
Genome map
AA seq 467 aa AA seqDB search
MLYSSKNKQSNDTYATPIFGITKDNYSIPKYKINENSIAPNIAYRMIKDELMNEGNARLN
LATFCQTYMEDKATKLMAETLQKNAIDKSEYPQTTEIENRCVNIISDLWNVPKDTNFLGT
STVGSSEACMLGGLSMKFRWRDQAEKLGIDINKKKPNLIISSGYQVCWEKFCVYWDIEMR
TVPMDEDNLSLNIDKVFDYVDEYTIGIIGILGITYTGKFDDIKALDEALEKYNNDHDIKV
YIHVDAASGGFFTPFINPEILWDFRLKNVVSINASGHKYGLVYPGIGWVLWKDQKYLPKD
LIFEVSYLGGKMPTLAINFSRSGSQIIGQYYNFLRFGFEGYKKIHERTKEVAMYISKELE
NTGLFSIYNDGSNLPIVCYKLKEQSKVKWNLYDLADRLAMKGWQIPAYPLPENLNHIIIQ
RIVCRSDLGYNLAELLIKDFKTAINDLNNAHILFHEKENQGSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctctattcttcaaaaaacaaacaaagtaatgatacctatgctacccccatttttggt
atcactaaggacaactactcaattcctaagtacaaaattaatgaaaattctattgcacct
aatatagcctatcgtatgattaaagatgaacttatgaatgaaggtaacgcacgcttaaat
ttagctactttttgtcaaacctatatggaagataaagctacaaaacttatggctgaaacc
ttacaaaaaaatgctatagataagtctgaatacccacaaactactgaaatagagaatcgt
tgtgttaatattatttcagatctttggaatgtcccaaaggatacgaacttcttgggtacc
tctactgtaggttcttcagaagcttgtatgttaggtggcctgtctatgaaatttcgttgg
cgtgatcaagctgaaaaattaggtattgatattaataaaaagaaacctaacttaataata
tcatctggttatcaggtatgttgggaaaaattctgcgtttattgggatattgagatgcgt
actgttcctatggatgaagataatctaagtttaaatatagataaggtttttgattatgta
gatgaatataccataggaattataggcatcttaggaataacttatacaggaaaatttgat
gatattaaagctttagatgaagcccttgaaaaatataataatgatcatgatataaaggtt
tatatccatgtagatgctgcctccggtggatttttcacaccttttattaatcctgaaatt
ttgtgggattttcgtttgaaaaatgtagtttctataaatgcatccggtcataaatatggg
ttagtttatccaggaataggttgggttctgtggaaagatcaaaaatatcttcctaaagat
ttaatatttgaagtaagttatttaggtgggaaaatgcctaccttagctattaatttttca
agatctggaagccaaataataggccagtattataattttttacgctttggttttgaggga
tataaaaaaattcatgagcgcacaaaagaagtagctatgtatatttcaaaagaacttgaa
aacacgggattattcagtatatataatgatggcagtaatcttcctatagtttgctataaa
ctaaaagaacaatctaaagtgaagtggaatctttatgatttagcagatagactagctatg
aaaggttggcaaatacctgcttaccccctccctgaaaatcttaaccatataataatacaa
agaatagtttgtcggtcagatctaggatacaatttagcagaactattaataaaagatttt
aaaacagcaataaatgatttaaataatgctcatatattatttcatgaaaaagaaaatcaa
ggtagttatggatttactcattag

DBGET integrated database retrieval system