KEGG   Clostridium sporogenes: CLSPO_c19340Help
Entry
CLSPO_c19340      CDS       T03905                                 

Gene name
aor
Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase Aor
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cld  Clostridium sporogenes
Pathway
cld00030  Pentose phosphate pathway
cld01100  Metabolic pathways
cld01120  Microbial metabolism in diverse environments
cld01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLSPO_c19340 (aor)
Enzymes [BR:cld01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLSPO_c19340 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N MTD
Motif
Other DBs
NCBI-ProteinID: AKC62654
UniProt: A0A2X3DY81
LinkDB All DBs
Position
complement(2142210..2144027)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRECTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIEPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSDVPV
YVNIEDDKIEIKEANHLWGKTSLETTEILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVFNEEEAKKVSLEKIKILREDPVAGGGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKVF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHDTESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagagaatgtactttg
gagcctttagatgaagaaaaggctaaaaagtttataggggctagaggccttggggttaag
actttattagaagaaatagaccctaaaatagaaccattatctattgaaaataaacttgtt
atagttacaggccctattactggagctcctatgccaaccagtggtagatatatggtagta
acaaaggctcctttaactggtactattgcaatatcaaactctggtggaaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagatgtacctgtt
tatgtaaacatagaagacgataaaatagaaataaaagaagcaaatcatctatgggggaag
acttcattagaaactacagaaattctttgtaatgagaacaatgaaagagcaaaagtatta
tgtataggacctgcaggagaaaaattatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggtgttggggctgtaatgggttcaaagaatttaaaagccata
gtagttaaaggttctggaaaagttaaagtgtttaatgaagaggaggcaaaaaaagtatcc
ctagaaaaaattaaaatattaagagaagatccagtggcaggtggaggattacctacttat
ggttctgctgtacttgtaaatataattaatgaaaacggggtacacccagtgagaaatttc
caaaaatcctatacagatgaggctgataaaataagtggagaaacccttacagaggattgt
cttgtaagaaaaaatccatgttatagatgtccaatagcctgtggtaggtgggtaaaatta
gatgatggtacagaatgtggaggcccagaatatgagactttatggtcctttggatctgat
tgtgacgtatatgatttaaatgctattaatgtagctaatatgctttgtaatgaatatggc
cttgatacaatttccgcaggggctactattgcagcagccatggagttatatgaaaaagga
tatataaaggatgaagatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaaaaagatggcattaagggaaggctttggagataaaatggca
gatggatcctatagattatgtgaatcctatggtgttccagagttttctatgacagttaaa
aagcaagaattaccagcttatgatccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcctatgctaaagtattc
cacgacttaacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggcggtaagttacatgataca
gaatctataatggaagcaggagatagaatctggacattagaaaagttatttaatttagaa
gctggtatagacagttcccatgatacccttccaaaaagattgcttaaagaacctattccg
gagggcccttctaagggatgtgttcataaattaagtgaattacttccagaatattatgca
gtaagaggatgggacaagaatggcataccaacagaggatacattaaaaaaattaggtctt
gaagaatatataaagtag

DBGET integrated database retrieval system