KEGG   Clostridium sporogenes: CLSPO_c22610Help
Entry
CLSPO_c22610      CDS       T03905                                 

Gene name
bdhA2
Definition
(GenBank) (R,R)-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cld  Clostridium sporogenes
Pathway
cld00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLSPO_c22610 (bdhA2)
Enzymes [BR:cld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CLSPO_c22610 (bdhA2)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CLSPO_c22610 (bdhA2)
    1.1.1.-  
     CLSPO_c22610 (bdhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C ApbA ADH_N_assoc ADH_zinc_N_2 Shikimate_DH Pyr_redox_3 Pyr_redox NAD_binding_7 GP68 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKC62981
UniProt: A0A2X3BTM3
LinkDB All DBs
Position
complement(2537067..2538140)
Genome map
AA seq 357 aa AA seqDB search
MKAALWYERKDVRVEEIEEPKVVKGSVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHALS
GTTAPVVLGHEFSGEIVELGEGVTKFNIGDRVIVEPIVACGKCPACMEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEGFVHKIPDEMSYEDAALVEPMAVGLHSVRMANFNTGDTALVLG
AGPIGLATIECLKAAGARLIVVLQRKSIRQKYAKRAGADVVLDPNEVNIPEEVKKLTGGV
GVDATFETTGAKIGFDTGLESLKYEGTMVITSIWEKDTNFNPNVLVFTEKKIVGTLAYRH
EFPATMALMKDGRIKTEGYITKKIALDDIVEEGFGALTGPEKKKHVKILVTPDKSLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgaaagaaaagatgtaagagtggaagaaattgaagaacca
aaggtagtaaaaggatctgtaaaaattaaagtgaaatggtgtggaatatgtggttcagat
ttacatgagtacttaggaggtcctatatttattccagtaggacaacctcatgcattgagt
ggaacaacagcaccagtagttttaggacacgaattttcaggagaaatagtagaattagga
gaaggtgtaacaaaatttaatattggagatagagtaattgttgaacctatagtagcttgt
ggaaaatgtccagcatgtatggaaggaaaatataatctttgttcatctttaggtttccat
ggactttgtggaagtggtggtggacttgcagaatatactgtatttccagagggttttgtt
cataaaatcccagatgaaatgtcctatgaggatgcagccttagtagagccaatggcagta
ggtcttcactctgtaagaatggctaattttaatacaggagacacagctttagtgttaggt
gcaggaccaataggccttgctacaatagaatgtttaaaggcagctggagcaagacttata
gtagttttacagagaaaatctataagacaaaaatatgcaaaaagagcaggggcagatgtg
gttttagatcctaatgaagttaatataccagaagaagttaaaaaacttacaggtggagta
ggtgtagatgctacttttgaaactacaggagctaagataggatttgatactggtcttgaa
agtttaaaatatgaaggtacaatggttataactagtatatgggaaaaggatacaaacttt
aatccaaacgtattagtatttactgaaaagaaaattgtaggaactttagcatatagacat
gaatttccagcaacaatggcattaatgaaggatggaagaataaaaacagagggatatatt
acaaagaaaatagctttagatgatatagtagaagaaggatttggtgctttaactggacca
gaaaagaaaaaacatgtaaaaattcttgtaactccagataaatcacttttataa

DBGET integrated database retrieval system