KEGG   Cellulosilyticum lentocellum: Clole_2951Help
Entry
Clole_2951        CDS       T01448                                 

Definition
(GenBank) Hsp33 protein
  KO
K04083  molecular chaperone Hsp33
Organism
cle  Cellulosilyticum lentocellum
Brite
KEGG Orthology (KO) [BR:cle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cle03110]
    Clole_2951
Chaperones and folding catalysts [BR:cle03110]
 Heat shock proteins
  HSP33
   Clole_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ADZ84648
UniProt: F2JLX2
LinkDB All DBs
Position
complement(3195691..3196566)
Genome map
AA seq 291 aa AA seqDB search
MKTKDYMIRGIDKERNFRFFGTNTKELVNTACINHGLTPVAAAALGRTLTGVAMMGSMLK
RDEDRVSIIIKGDGPLGGIIAESNGAGDVKGYVYNPHVDLPLNEFGKLDVAGAVGNANMT
VMKDLGLKEPYSGQVPMLSGEIAEDISFYFAVSEQTNSVVMLGVLVDVDYSIRQAGGIII
QVLPDADDDAITQLEKKIKGFKSLTACLEKGQSIEYVLENLLGEIEIMDTTEVRFNCDCS
KERMERALISVGKKDLEEIAKEDEKAELVCPFCSNKYQFTKEELEELIEQI
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaagactatatgattagaggaatagataaagaaagaaactttagatttttt
gggactaatacaaaggaacttgtcaatactgcttgcattaatcatggattaacaccagta
gcagctgctgctttaggtagaacattaacaggggttgctatgatgggaagcatgcttaaa
agagatgaagaccgtgtaagcattattattaaaggagatggaccgctaggtggtattatt
gctgaatctaatggggctggagatgtaaaaggatatgtttataatcctcatgtagacttg
ccactcaatgagtttggtaaactagatgtagcaggtgctgtaggaaatgccaatatgact
gtgatgaaggatcttggtcttaaggaaccttactcaggccaggtacctatgctttctggt
gaaattgcagaagacattagcttttacttcgctgtatcagaacaaactaattcagtcgtt
atgttaggtgttttagtggatgtagattatagtattagacaagcaggaggtattattatt
caagtgttacctgatgcagatgatgatgccattactcaattagagaaaaaaatcaagggg
tttaaatctttaacggcgtgtttagaaaaaggacagtctatcgagtatgttttagaaaat
cttttaggtgagattgaaatcatggatacaacagaagtaaggtttaattgtgactgttct
aaagaacgtatggaaagagcccttattagtgttgggaaaaaagacttagaagaaattgca
aaggaagatgaaaaagcagagcttgtatgtcctttctgcagtaacaaatatcaatttacc
aaagaagaattagaggaactcattgagcaaatctaa

DBGET integrated database retrieval system