KEGG   Cellulosilyticum lentocellum: Clole_3017Help
Entry
Clole_3017        CDS       T01448                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cle  Cellulosilyticum lentocellum
Pathway
cle00473  D-Alanine metabolism
cle01100  Metabolic pathways
cle01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clole_3017
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Clole_3017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cle01011]
    Clole_3017
Enzymes [BR:cle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Clole_3017
Peptidoglycan biosynthesis and degradation proteins [BR:cle01011]
 Precursor biosynthesis
  Racemase
   Clole_3017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADZ84714
UniProt: F2JMR3
LinkDB All DBs
Position
complement(3270171..3271304)
Genome map
AA seq 377 aa AA seqDB search
MESHRPRVVAEVNLGAIEHNYKQIRQHIPNHTEIMAIVKADGYGHGAKEVANFLQEQGVN
RFAVAIVAEGEELRSSGITSPILVLGYTPRADIKTLIENDLTQTVFSYEMAKTISDEAGR
LGKTVNIHLKVDTGMGRIGFLSSPKSIEEILMITKLPHINLEGIFTHFSTADEEDTSYTK
EQWSIFEGFLKELSEVGLELPIIHAANSAAIMCHEYTHLNLVRPGIILYGYYPSPYLGGK
VLDLEPAMTLKTQVVHVKELPEGQYVGYGRKFYTHQKTKIATIPVGYADGYSRNLGNKGR
VLIRGQYAPIIGNICMDQFMVDVTHIKGVSVEDEVVLFGKQQDAVIPVEEIAQSLGTINY
EIVCMIGKRVPRIYIKP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcatagaccacgtgttgttgcagaagttaatttaggtgcaatagaacataat
tataaacaaattcgtcagcatataccgaatcatacagaaataatggctattgtcaaagca
gatggttatggtcatggtgccaaggaagtagcgaactttttacaagagcaaggtgtcaat
cgttttgcagttgctattgtagcagaaggtgaagaactaagaagtagtggtatcacatca
cctattttagttttaggctatacaccacgagcagatattaaaacacttatagaaaatgat
ttaactcaaactgttttttcttatgaaatggcaaaaaccatatctgatgaagcaggccgc
cttggtaagaccgtcaatattcatttaaaggtagatacagggatggggcgcattggtttt
ttatcgtcacctaaaagtatagaagagattttaatgattacaaagcttcctcatattaat
ttagaaggtatttttacacacttttctacagcggatgaagaagatacaagttatacaaaa
gaacaatggagtatatttgaaggctttttaaaagaattaagtgaagtagggcttgaactt
cctattattcatgcagctaatagcgcagccattatgtgtcatgagtatacgcatttaaac
ttagtaagacctggtattattctttatggatactatccttcaccttatttaggagggaaa
gtactagaccttgagccagccatgacacttaaaacgcaagttgttcatgtgaaagaactg
ccagaaggtcagtacgtcggctatggtagaaaattttacacccatcagaaaactaaaatt
gctacgattccagtcggttatgcagatggttattcaagaaatttaggtaataagggcaga
gttctcataagaggacagtatgcacctataataggaaatatttgtatggaccaatttatg
gttgatgtcactcatatcaaaggtgtatccgtagaagatgaggttgtactctttggtaaa
caacaagatgcagtcattccagttgaagaaattgctcaaagcttaggcaccattaattac
gagattgtatgtatgattggtaaaagagttccacgtatttatataaaaccttaa

DBGET integrated database retrieval system