KEGG   Cellulosilyticum lentocellum: Clole_3577Help
Entry
Clole_3577        CDS       T01448                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
cle  Cellulosilyticum lentocellum
Pathway
cle00440  Phosphonate and phosphinate metabolism
cle01100  Metabolic pathways
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Clole_3577
Enzymes [BR:cle01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Clole_3577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ADZ85260
UniProt: F2JT41
LinkDB All DBs
Position
complement(3894322..3895617)
Genome map
AA seq 431 aa AA seqDB search
MKKVYMCFGTDVIHNGHIEILRKAAELGEVTVGVLTDEVMASYKRYPIINLEQRLQIIES
IKYVSKVIVQEELDYTNNLRKVKPDYVVHGDDWRTGYQASIRSKVIDILKEWDGELVEFP
YTEDNNIKCLENTMRERLSMPEFRRARLRKLLKMNRTIRVLEVHSGITGLIAENTKLEKD
GKINEFDAMWLSSLCDSTVKGKPDIELVDMSSRLKTIEEILEVTTKPIILDGDTGGLVEH
FNFNIRTLERMGVSAIIIEDKEGLKKNSLFGTEVHQDQASIESFCEKIRVGKAALKTKEF
MLIARIESLILEKGMEDALARAQAYVNAGADGIMIHSRKKEPDEIFAFCDAFRLQNKQTP
IIVVPTTFNKVYEEELYNHGINIVIYANQLIRSAFPAMQNTARVILENERAYEVDKLCMP
VKEILTLIKER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatatatgtgttttggaacggatgttattcataatggacatattgaaata
ctgagaaaagcagctgagctgggtgaagttacagtaggtgttctaacggatgaggtaatg
gcatcatataaaagatatcctattattaatctagaacagagattgcaaattattgaatct
attaaatatgtttcaaaagtcattgtacaagaagaattggattatacaaataatttaaga
aaagtaaaacctgactatgtagttcatggtgatgattggcgtacaggttatcaagcatct
ataagaagtaaagtgatagatatattaaaagaatgggatggagaacttgtagaatttcct
tacacagaagacaataatattaaatgcttagaaaatactatgagggaaagattatccatg
ccagagtttagacgtgcaaggctaagaaagctattaaagatgaatagaaccattagagtt
ctagaggtacatagtggcattacaggattaattgcagaaaatacaaaactagaaaaggat
ggcaagataaatgaatttgatgctatgtggttatctagtttatgtgattctacagtaaag
ggaaaaccggatatagaattagtagacatgtcttctagattaaaaactatcgaggaaatt
ctagaagtaaccactaagccgattatattggatggagatactggcgggttagtagagcat
tttaactttaatattagaactttagagcgtatgggtgtatctgctattattattgaagat
aaagaagggcttaagaaaaatagtttgttcggtacagaagttcatcaagaccaagctagt
atagaaagtttttgtgagaaaattagagtaggaaaagcagcccttaaaactaaggagttt
atgttaatagctagaatagaaagtctaatcttggaaaaagggatggaagatgccttagca
agagcgcaggcttatgtgaatgccggagctgatggtattatgattcattctagaaaaaaa
gagccagatgaaatatttgctttttgtgatgcatttaggctgcagaataaacaaacacct
attattgtagtaccaactaccttcaataaagtatatgaagaggaattatataatcatggg
attaatatagttatttatgcaaatcaactcattagaagtgcttttccagcaatgcaaaat
actgctagagttatcctagaaaatgagagagcttatgaagtagataaattatgtatgccg
gttaaagagatattaaccttaataaaggaaagataa

DBGET integrated database retrieval system