KEGG   Cimex lectularius (bed bug): 106661569Help
Entry
106661569         CDS       T05603                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec03030  DNA replication
clec03410  Base excision repair
clec03420  Nucleotide excision repair
clec03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:clec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106661569
   03410 Base excision repair
    106661569
   03420 Nucleotide excision repair
    106661569
   03430 Mismatch repair
    106661569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clec03032]
    106661569
   03400 DNA repair and recombination proteins [BR:clec03400]
    106661569
Enzymes [BR:clec01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106661569
    6.5.1.6  DNA ligase (ATP or NAD+)
     106661569
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106661569
DNA replication proteins [BR:clec03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106661569
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106661569
DNA repair and recombination proteins [BR:clec03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106661569
   NER (nucleotide excision repair)
    Other NER factors
     106661569
   MMR (mismatch exicision repair)
    Other MMR factors
     106661569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 106661569
NCBI-ProteinID: XP_014240558
LinkDB All DBs
Position
Unknown
AA seq 881 aa AA seqDB search
MSQNSLMCNENLAKSFFKKVDTTQKPLKSTVLSPESVKNGDGGDNKELSKELDSPVRANA
VKRKRSRKIESDSEEEEATNKNVKETVSSELPKDVESDSTSSNKVPTSESKTKKASQSSP
ESKHTKSSKRRKSSKTKSDSSRSESTDETVVNFTKNVSPKIVINKAPEICLKQKSEENDE
VSPENETSQENNEVSQMKDEISEEKETPKKAEPCKLTNGEKCSNFTDFNPSKLRYDPIKD
ACWEKGAKVPYIALSKTLEKIEEISARLKIIEILSNYFRSVIVLSDFDLLPSVYLCLNQL
APAYEGLELGIAETSLIKAIAQTTGRSVAQIKAQATKLGDLGLVAEQSKCSQRMMFTPPP
LTVQGVFTKLKEIANMSGSTSQVKKVDKIQGLFVACKGPEARYLIRSLAGKLRIGLAEQS
VLQALALACVMTPPGQEFPPKILNASKGLSPEKFKSMLDKEALILKTTYCECPNYDKIIK
VIVEEGIKELPNKCQLTPGLPLKPMLAHPTKGVKEVLHRFEGLKFTCEWKYDGERAQIHL
DNDGKVSIYSRNQENNTSKYPDIISRLKSAVKEGVESFILDTEAVAWDLETKKIRPFQVL
TTRKRKDADESEIKVQVCVFMFDLLYLNGQPLVKKPLIERRQLLKENFQEVESQFTFATS
LDTNKMEEVQDFLDESVKGNCEGLMVKTLEEEATYEIAKRSRNWLKLKKDYVDGIGDSLD
VVVIGGYLGKGKRTGLYGGFLLACYDPENEEYQSICKIGTGFTDEDLKNHSEFFKEHVIN
SPKSYYRYDSSHEPDHWFEPVQIWEIKCADLSLSPVHRAAIGIVDPEKGISLRFPRFLRI
RDDKTVEEATSAQQVADLYNSQDQIKNQQNEGSKVNEADFY
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaattctctcatgtgcaatgaaaatttggccaaatcctttttcaaaaaagtt
gatacgactcaaaaaccattgaaaagcaccgttctaagtcctgaaagcgtaaagaatggc
gatggaggggacaacaaggagttatcgaaggaacttgattctcctgttcgagctaatgca
gtaaaaaggaaacggtcgagaaaaatcgagagcgacagtgaagaagaggaggccacaaat
aaaaatgtaaaagaaactgtttcatctgagttgccgaaagatgtggaatcagactcgact
tcaagcaacaaagtacctacatcagagagcaaaaccaaaaaagcatcacaaagcagccca
gagtcaaaacataccaaaagcagtaaacgtaggaagtcctcaaaaacaaagagtgatagt
tcgaggagtgaaagcactgacgaaacagttgtaaactttacaaaaaatgtttcacctaaa
atagtaataaacaaggctcctgaaatttgcctgaaacagaaatctgaagaaaacgacgag
gtttctccagagaatgagacttctcaagagaacaatgaagtttctcaaatgaaagatgag
atttctgaagaaaaagaaacgccaaaaaaagcagaaccgtgtaaattgaccaatggtgag
aaatgcagcaacttcaccgacttcaatccaagcaaattgagatacgacccaatcaaagac
gcctgctgggaaaaaggcgcaaaagtgccatacattgccctctcaaagacgctggagaaa
attgaagagatatcagcgcggttgaaaataattgagattctgagcaattactttcgttct
gtgatcgtcctgagcgattttgacctcctgccttctgtatacttatgcttgaatcagctc
gccccagcctatgagggcttggagttgggaatcgctgaaactagtcttattaaggctatt
gctcagacaacaggtagaagtgttgcacagatcaaggcacaagcaaccaagcttggcgac
ctcggcctggtagctgaacagagcaaatgttcacagaggatgatgttcacaccacctcct
ctcaccgtccagggcgtttttacaaagctgaaggaaatcgccaatatgagtggctcgaca
tctcaggtgaaaaaagtagacaaaatccagggtttgtttgtagcctgcaaaggtcctgag
gctagatacttgataaggtctctagctggtaaattaagaattggattagcagaacaatct
gttttacaagccctggctcttgcgtgcgtcatgacaccccctgggcaagaatttccacct
aagatcctcaacgcttcaaaagggttgtcgccagaaaagttcaaatccatgctcgacaaa
gaggcgttgattttgaagacaacgtattgtgaatgtccaaactatgataagatcatcaag
gttatcgtggaggaaggcataaaagaattgcccaacaaatgccaactgacgcctgggctt
cctttgaaacccatgctcgctcatccgacaaaaggagtcaaggaggttttacatcggttc
gaggggctgaagttcacatgtgaatggaaatacgacggtgaacgggcacaaattcatcta
gacaatgatggaaaagtgtcgatttatagccgtaaccaagaaaacaacacgtctaaatac
ccagacattatttcaagattaaaatctgctgtgaaagaaggagtagagtcgtttatactc
gatacagaagccgttgcttgggacttggaaaccaagaaaattaggccttttcaagtactc
actacacgaaagagaaaagatgcagatgagtcggaaattaaagtccaggtgtgtgttttc
atgtttgacctgctttatctaaatggccagccacttgttaaaaagccgttgattgaaagg
aggcagttactcaaggaaaacttccaagaagtcgagagccagtttacatttgcgaccagt
ctcgacactaataagatggaagaggtgcaggactttttagacgaatctgtcaaaggaaac
tgtgagggtcttatggtcaaaacgttagaggaggaagcaacttatgaaatagccaagagg
tcgagaaactggttgaaactgaaaaaagactacgtggacggtatcggcgacagccttgat
gtagtagtgattggtggttaccttggaaagggaaaacggactgggctttacggcggattc
ctcctagcgtgctatgacccagaaaatgaagaatatcagtcaatatgcaaaattgggaca
ggatttacagacgaggatcttaaaaaccactcggaatttttcaaagagcatgtcatcaac
agccctaagtcatattatcgctatgactcttctcacgagcctgaccactggttcgaaccg
gtacaaatttgggagataaagtgtgccgatctttccctttctccagttcaccgagcagca
attggcattgttgatccggaaaagggcatttcactcagatttccaagatttttaaggatc
agagatgataaaactgtggaagaagcaacatcagctcagcaggttgccgatttgtacaac
agccaggaccaaatcaaaaaccaacaaaatgagggcagcaaagtcaatgaggctgatttt
tattaa

DBGET integrated database retrieval system