KEGG   Cimex lectularius (bed bug): 106662313Help
Entry
106662313         CDS       T05603                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00010  Glycolysis / Gluconeogenesis
clec00053  Ascorbate and aldarate metabolism
clec00071  Fatty acid degradation
clec00280  Valine, leucine and isoleucine degradation
clec00310  Lysine degradation
clec00330  Arginine and proline metabolism
clec00340  Histidine metabolism
clec00380  Tryptophan metabolism
clec00410  beta-Alanine metabolism
clec00561  Glycerolipid metabolism
clec00620  Pyruvate metabolism
clec00981  Insect hormone biosynthesis
clec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106662313
   00053 Ascorbate and aldarate metabolism
    106662313
   00620 Pyruvate metabolism
    106662313
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106662313
   00561 Glycerolipid metabolism
    106662313
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106662313
   00310 Lysine degradation
    106662313
   00330 Arginine and proline metabolism
    106662313
   00340 Histidine metabolism
    106662313
   00380 Tryptophan metabolism
    106662313
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106662313
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106662313
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106662313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106662313
NCBI-ProteinID: XP_014241818
LinkDB All DBs
Position
Unknown
AA seq 507 aa AA seqDB search
MLKAVRSSIIKRHFTLPAPQTQPKIQHTQLFINNQWVPSASKEVFPVLNPTTGETITQVA
KGNKDDVDMAVDAARKAFARGSPWRTMNASQRGAILHRLADLMEKDHVYLASLETLDNGK
PYVMAYSSDIPSAVSVLRYYAGWADKIHGKTIPCDGNFFSYTRHEPVGVCGQIIPWNFPL
LMWAWKIAPALATGNTVVLKPAEQTPLTALRAAELCKLAGLPDGVVNIVTGFGDTGAAVA
NHKDVDKVAFTGSTEVGKLILQASGNTNLKKITLELGGKSPNIIMDDADMDQAVEGAHFG
TFFNMGQCCCAGTRVYVHEKVYDEFIEKSKKKAMERVVGNPFDPQTEHGPQIDEEQMNKI
LSYIESGKKQGANLVTGGERVGTKGYFIQPTIFSNVKDDMVIAREEIFGPVQQVLKFKDV
EEVIDRANDSNYGLAAAVFSKNVDTVNKVSQALRAGTVWVNCYNVLTPQAPFGGYKMSGH
GRELGEYGLSAYTEVKTTFVSMDQKNS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggccgtacgaagcagcataatcaagagacatttcactcttccggcgccccag
actcaacctaaaatacagcacactcagctgtttatcaacaaccaatgggttccatctgcg
agcaaagaagtatttcctgttttgaacccaacaacaggagaaacaattactcaagtggcc
aagggtaacaaggatgatgttgatatggcagtggatgcggccagaaaagcctttgccagg
ggatcaccatggcgtacgatgaatgcatctcaacgtggtgctattttgcaccggttggca
gatctcatggaaaaagaccacgtttatttggctagcctggaaacgttagataatgggaaa
ccttatgtcatggcgtattcaagtgatattccatctgcggtttcagttctccggtattac
gcaggttgggctgacaaaattcatggaaagaccattccatgcgatggtaactttttctct
tacacacgtcatgagccagttggcgtctgtggccagatcattccctggaactttccattg
ttgatgtgggcttggaaaatcgctccggcccttgctactggaaacaccgtagtacttaaa
ccagctgagcaaactcctctcaccgctttaagagctgctgagctttgcaaattagctggt
ctgcctgatggtgttgtcaacattgtgactggtttcggtgacactggagctgcagtagct
aatcataaggatgtcgataaagttgcatttactggatcaactgaagttggaaaattaatt
cttcaggcttcaggaaataccaatcttaaaaaaatcacactcgagcttggaggaaaatca
ccaaatataataatggacgatgctgatatggaccaagcggtcgaaggcgctcactttggc
acatttttcaacatgggccagtgctgctgtgctggaacgagggtttatgttcatgaaaaa
gtgtatgatgaatttattgaaaagagcaagaagaaggcaatggaaagggtagttggcaac
ccgtttgacccacagaccgaacatggacctcaaattgacgaagaacaaatgaataaaatc
ctctcatacattgaaagtgggaaaaaacaaggtgcaaacctcgtcactggaggtgaacgt
gtaggcaccaagggatatttcatccaaccgacaatattctcaaatgtaaaagacgacatg
gttattgcgcgggaagaaatttttggaccggttcaacaagttttgaagtttaaagacgta
gaagaagtgattgacagggctaatgactctaattatggacttgctgcggcagtattttca
aaaaatgtcgacactgtaaataaagtcagtcaagcactcagagcaggaactgtttgggta
aattgttacaacgtcttaactccacaagcaccgttcggaggttacaagatgtctggccat
ggcagggaactgggagaatatgggctttccgcttacactgaagtgaaaacgacttttgtc
agcatggatcagaaaaattcataa

DBGET integrated database retrieval system