KEGG   Cimex lectularius (bed bug): 106665111Help
Entry
106665111         CDS       T05603                                 

Definition
(RefSeq) glutamyl aminopeptidase-like isoform X1
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
clec  Cimex lectularius (bed bug)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clec01002]
    106665111
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clec04147]
    106665111
   04090 CD molecules [BR:clec04090]
    106665111
Enzymes [BR:clec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     106665111
Peptidases and inhibitors [BR:clec01002]
 Metallo peptidases
  Family M1
   106665111
Exosome [BR:clec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106665111
CD molecules [BR:clec04090]
 Proteins
  106665111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 106665111
NCBI-ProteinID: XP_014246802
LinkDB All DBs
Position
Unknown
AA seq 906 aa AA seqDB search
MAHNGQTNLPHVMRVTDMLEKMCPDIWRARVWEFDHRLPEAVRPVHYDLHLDPRMELAFF
NGKVTIDIDVFENRNYLFLHMKGLNMLSSQLFTANGVSIPILDAFPFKKNEYWVILTEET
LPPGAYILRFDFNGDLSGSVVGMFQQRLKSSLQPPNDESENLIVFTHMEPQYARRVFPCF
DEPSFKATFSVRLVKPDGYTALSNMPQLCEVESCPRSGNSTVTFDKTPPMSTYLLAFVIT
NFKPTPVLASCGGVPIRVFAKVPTHPDVLNTQKLALDAMDWMENYFKISYPLPKLDILAV
PDFASGAMENWGMIIIREMKMSRDADVIDWETINYTMGHELANQWFGNLATIVWWDDIWL
KEGMAMFLSNLMLDDIFPEMQGIPNFVEAQLHRGLVSDATLCTRQLLQQVIYPCDIADVF
DAITYTKAAAILRMFESTNPDKFRKGVQNFIHMFKYSNGTSQDLWRLIDDSVHAEDWVHA
FNTWVGQPGYPLILAARGTCTLAVQQIRCLNDIALRFDTQDSPYQFRWDVPIQYVTSLNP
CEPELLWLSSDEKEARADLPSGVCWFKMNIRQHGFYRVTYHQQEWMNLREVLLNTPEVLT
PEDRANLLDDSFFLAHAGFVCYGIPLQLATYLRYGKEDHWLPWATFSKHLSLMRNALSND
EKDVETLFEYARSIVDRQLTDELWFIEPSEPIKDRKYKLALLKIGCKLRIPHMIEQVGNL
FQTWSYNPHSKDHVDIRRVIVKHGITNRDAWLMVFELYLTERDTIEKCLYLESLASIKDP
ELCQKLLDHMLTENKPDDQELFLVLFTMANNPIGNKEVWAFIKSNWDALLDKYYLSETCL
GLVLPHIAQFFNTEEQLDDMKEFLKGKQITSAICSLDQIQHNLNWNTKYRKILLGWLNLL
LEGKVC
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggctcacaacggacagacaaatctacctcacgtcatgagggtgacagacatgctagaa
aaaatgtgccctgatatatggagggcaagggtttgggaatttgaccatcgacttccagaa
gctgtcagacctgtgcactatgatttacatctcgacccaagaatggaactggcttttttc
aacgggaaagtcaccatagatattgatgtatttgaaaacagaaattatctcttcctacat
atgaaagggctgaatatgctgagcagccagctcttcactgcaaatggtgtctctattcct
atacttgatgcatttcctttcaagaagaatgagtattgggtgatactgactgaagaaaca
ttgccaccaggagcttatattctcagatttgatttcaacggagatctttcaggttccgtc
gttggtatgtttcagcaaagattgaagagttctcttcaaccaccaaacgatgaaagtgaa
aatttgattgtatttactcatatggaaccacaatatgccagaagagtctttccatgtttt
gatgaaccatcattcaaagcaactttttctgtccgccttgtaaaacctgatggatacacc
gctttatcaaacatgcctcaactgtgtgaagtggagtcttgccctcgttctggaaatagc
actgtcacttttgacaaaacacccccaatgtccacatacttgttagcatttgttattact
aacttcaaacccacccctgttctggcctcttgtggcggagtacctattagggtgtttgca
aaagtacccacacacccggatgtgttaaacacacaaaaattagccctagatgcaatggac
tggatggaaaactattttaaaattagctatcctctccctaagctagatatcttggcagtg
ccagattttgcatctggggcaatggaaaactggggcatgataatcatcagagaaatgaaa
atgagcagagatgcagatgttatcgactgggaaactatcaattatacaatgggccatgaa
ctggccaatcagtggtttgggaatcttgcaactattgtttggtgggatgacatctggcta
aaagaaggtatggcaatgttcttgtcaaacttgatgttagatgatatatttcctgaaatg
caagggataccaaattttgttgaagcacaacttcatcgtggtcttgtaagtgatgcaaca
ctatgcacccgacagctcttacagcaagttatttatccatgtgacattgctgatgtcttt
gatgcaataacttacacaaaagcagccgcaatcttgagaatgttcgaaagtaccaatcca
gataaatttaggaaaggagtgcaaaacttcattcacatgtttaaatattcaaacgggacg
agccaggacctctggcgcctcatagatgattctgtacatgctgaagattgggtccatgcg
ttcaacacttgggttggacaaccaggatatcccttgattttagctgcaagaggaacatgc
acacttgcagtgcagcaaataagatgccttaatgatattgcacttcgttttgacacacag
gattcgccttatcaattccgatgggatgttccaatccagtatgtaacttctttgaatcct
tgtgaacccgaactgttatggctttcaagcgatgaaaaagaggcaagagctgatcttcca
agtggcgtttgttggttcaaaatgaacataagacagcatggtttctacagagttacatat
caccagcaagaatggatgaacttaagagaagttttgctgaacacccctgaggtgttgacc
cccgaggacagagccaacttactagatgattcattttttttggcacatgcagggttcgtc
tgttatggtatccctcttcagttagcaacttatctgagatacggtaaggaagaccactgg
ctaccatgggctactttttctaaacatttgtcccttatgagaaatgctctcagcaatgat
gaaaaggacgtagagacgctttttgagtacgcccgaagtatcgttgatcgacaattaacc
gatgagctatggtttattgaaccgtctgagccaatcaaagacaggaagtataagttggcc
ttgctgaaaataggttgtaaactacgaattccacacatgatcgaacaggtgggcaacttg
ttccaaacatggtcctacaaccctcatagtaaagaccatgtagatataagacgagtcatt
gtaaaacacggcattacaaacagagatgcctggctaatggtctttgaattatatttaact
gaaagagacactattgaaaagtgcctttatctggagtcactggcatcgattaaagaccca
gagttgtgccaaaagttgctagaccacatgttgactgaaaataaacccgatgaccaggaa
ttatttctggtactgttcacaatggcaaataatccaattggcaacaaggaagtttgggca
tttattaagtctaactgggatgctcttctggataagtactacctcagtgagacatgttta
gggctagttcttccacacatagcacagtttttcaacactgaagaacaattggatgatatg
aaagagttcttgaaggggaagcaaattaccagtgctatctgttctctggaccagatacaa
cacaacctaaactggaacacgaaatacaggaaaatccttctcggctggctcaatctttta
ttggaaggaaaagtctgttaa

DBGET integrated database retrieval system