KEGG   Cimex lectularius (bed bug): 106665808
Entry
106665808         CDS       T05603                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like isoform X1
  KO
K20017  Bcl-2 family protein
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec04214  Apoptosis - fly
clec04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:clec00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    106665808
   04215 Apoptosis - multiple species
    106665808
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 106665808
NCBI-ProteinID: XP_014248026
LinkDB
Position
Unknown
AA seq 277 aa
MARPTIRIVVSDAGGGEDSFLATRPSGAGRRKLSSPATLLGPRPISRRFSNVGLTARKFS
HSLGWGSSAAQAEIVSQGRALCIQYIRSRLKRSGVFTKKCGLQRLRSTASLPGGYVVRQV
LPDLISIGTELERLHPKVYTNVGRQISTLPGGAAASEKALASGLAAVAKELCQGPITWAT
VVSLYAIAGGLAVDCVRGGHPEYMTSLVEAMSVAVEEELASWIADNGGWPGLCSYCKPLS
PEVSLSAFLALLGALIGTAFLIILLLRLFGRFKAYIH
NT seq 834 nt   +upstreamnt  +downstreamnt
atggccaggccgaccatccgtatcgtcgtaagcgatgcgggtggaggtgaggacagcttt
ctggctactaggccttcgggggcgggccgaaggaagctctcgtctccagccacactcctc
ggccctcgacccatctcaagacgattttccaacgtaggcctcacagctcggaaattttcc
cattctctcggctggggatcttcggcagcccaggcagagatagtgtcccaaggcagagca
ctctgcattcaatatatacgctcaagactgaaaagaagcggtgtgtttacgaagaaatgc
ggtttgcaaagactcagaagcacggcgtcacttccaggcggttatgtcgtcaggcaagtt
cttccggatctgattagtatagggaccgaactggaaagactccatcctaaggtatatacc
aatgtaggccggcagatttcaactttaccgggaggcgctgctgcatctgaaaaggccctt
gcaagtggactggcagcggttgctaaggaattatgccagggtccgataacatgggccacc
gttgtttctctgtatgcaattgctggaggacttgcagttgactgtgttcgtggaggccac
cctgagtacatgacttcgctagtagaagccatgtcagttgcagtcgaggaagaattggcc
agctggattgctgacaacggtggctggcctggactatgttcatattgcaagccactatcg
ccagaagtctcattaagtgcatttttagcattgctaggagctcttattggaacagcgttt
ttaattatcctcttgttaagactctttggacgatttaaagcatatattcattaa

DBGET integrated database retrieval system