KEGG   Cimex lectularius (bed bug): 106666408
Entry
106666408         CDS       T05603                                 

Definition
(RefSeq) rhodopsin, GQ-coupled
  KO
K04332  prostaglandin D2 receptor
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:clec00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106666408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:clec04030]
    106666408
G protein-coupled receptors [BR:clec04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    106666408
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 106666408
NCBI-ProteinID: XP_014249082
LinkDB
Position
Unknown
AA seq 337 aa
MDLDNLANITESLQNATFIAVEKSPTNAQVRHAVITVIYFMGVIGNLSALGFLYASSAAP
KNLRHLLVLKCLAFNDLLAVVGMWIQMNLRTLIPSIARSQWFCAFRVIWRCFGIGSGCIV
CIMAIDRWIALTRPLFYLKHMTLGTIKKSLLILWAINLLIVCSPLFGFGLYFENGRCVRY
KMAVRTLDRVYALVYFSFGFLLCCSLILCNLSVMKNLSAPKQKKKVLVRRISRNRDLTCS
ASTYEELAFARLMGVLCAVIIICWLPQLITIPISQLYNETEWCKIFMNLGDLIYAVHFTL
DPYFYILLRWTWFKSLCRKKVSSRGNSTKTTQELCSL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggatctggacaatttggccaacatcaccgaaagtcttcaaaatgccaccttcatcgcc
gtggagaaaagccctaccaatgcgcaagtgcgacacgccgtcatcactgtgatttatttc
atgggagtcatcggcaatctgtcagcactcggttttctttatgcgtcttctgcggcgccg
aaaaatctcaggcacctcctcgtcctgaaatgtctggctttcaacgatctactcgccgtc
gtcggcatgtggatccagatgaacctgaggaccctcataccgtcaatcgcacggagccaa
tggttctgcgcttttcgggtcatttggagatgttttggaatcggatccggatgcattgtc
tgcattatggccatcgaccgctggattgcactcacaagacctctattctaccttaagcac
atgaccctggggacaataaagaaatctttattaatcctctgggcaataaaccttttgatc
gtctgctctcctctctttggatttggactttactttgagaacggaagatgcgtgcgttac
aaaatggcggttcggacattggacagggtgtatgccttagtttatttctcattcgggttt
ctgttgtgctgttctttaatactgtgcaacctctcagtcatgaagaatctttcagcacca
aagcaaaagaagaaggtgcttgtaaggaggatatcaagaaatcgcgatctgacttgctct
gcttcaacttatgaagagctagcattcgctcgtctgatgggagtactttgtgctgtcatt
attatttgctggctaccacagctgattacaatacccatctcccaactgtacaatgaaact
gaatggtgcaaaatatttatgaatcttggcgaccttatttacgcagttcactttacatta
gatccttatttttatatactgctcaggtggacatggttcaaaagcctctgcagaaaaaaa
gtctcctcaaggggaaattcaacaaaaacaacacaagagctgtgctctctctga

DBGET integrated database retrieval system