KEGG   Cimex lectularius (bed bug): 106667074Help
Entry
106667074         CDS       T05603                                 

Definition
(RefSeq) sorbitol dehydrogenase-like isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00040  Pentose and glucuronate interconversions
clec00051  Fructose and mannose metabolism
clec01100  Metabolic pathways
Module
clec_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    106667074
   00051 Fructose and mannose metabolism
    106667074
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     106667074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C SopE_GEF
Motif
Other DBs
NCBI-GeneID: 106667074
NCBI-ProteinID: XP_014250234
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MACDNLTAVLYKTNDLRLENRPIPEPTDNEVLLEMGSVSICGSDVHYLQHGRICDFIVKE
PMIMGHEASGTVVKLGSKVKNLNIGDRVAIEPGVPCSTCEYCKEGRYNLCPDIAFCATPP
FHGNLSRFYCHKADFCFKLPHNVSLEEGALLEPLSVGVHACKKAEITIGSKLLVLGVGPI
GLVTTLIAKAMGAEKIIATDLQKHRLELAKICGADHTVQINGTESENDLEKVIRETLGGQ
PDKTIDCSGFESSIRLGLKATKSGGTFVLVGMGAHEVKLPLVSAAIKEITIKGAFRYCNE
DIFIFSYAVALSLVATGKVNLKPLITHEFSLKDTIKAFETASNGTGNPVKILIHCNK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtgacaacctgacagcagttctttataaaaccaatgacctgagattggaaaat
cgcccgattccagaaccaacagacaatgaagtcctattggaaatgggatcagttagtatt
tgcggatctgatgtccactaccttcaacatgggagaatttgtgattttattgtcaaggaa
cccatgataatgggccatgaggctagtgggacagttgtgaaacttggatcaaaagtgaaa
aacttaaatataggtgatcgtgtcgctattgagccgggtgtgccatgcagcacatgtgag
tactgcaaagaagggaggtacaatctctgcccagatattgcgttttgcgctacaccacct
ttccatggcaatctttcaagattctactgtcacaaagctgatttttgcttcaaattacct
cacaatgtgagcctagaagaaggagcacttcttgaaccattatcagttggagtgcatgct
tgtaaaaaggctgagatcacaatcggatctaaattgctagtgctaggagtgggcccgatt
ggacttgtcacaactctcatagcgaaggcaatgggagctgaaaaaattatagcaactgat
ttacagaaacatcgattagagttagcaaagatatgtggggcagatcatactgtacaaatt
aatggtactgaaagcgaaaatgatcttgaaaaggttatcagagaaactttgggtggccag
cctgataaaacaattgactgtagtggatttgagagttcaatcagacttggtttgaaggcg
actaagagtggtggaacattcgtactggttggaatgggtgcacatgaggttaaattgcct
ctcgttagtgctgcaattaaagaaatcactataaagggtgcctttagatattgcaatgaa
gacatttttattttcagctatgcagtagcattgtcgcttgttgctactggaaaagtcaat
ctgaaaccattgatcactcatgaattttcactcaaggacactataaaagcatttgaaact
gcttcaaatggcactggaaatcccgttaaaattttgattcattgcaacaaatga

DBGET integrated database retrieval system