KEGG   Cimex lectularius (bed bug): 106668013Help
Entry
106668013         CDS       T05603                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00562  Inositol phosphate metabolism
clec01100  Metabolic pathways
clec04070  Phosphatidylinositol signaling system
clec04310  Wnt signaling pathway
clec04745  Phototransduction - fly
clec04933  AGE-RAGE signaling pathway in diabetic complications
Module
clec_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106668013
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106668013
   04070 Phosphatidylinositol signaling system
    106668013
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    106668013
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106668013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clec04131]
    106668013
Enzymes [BR:clec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     106668013
Membrane trafficking [BR:clec04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    106668013
 Endocytosis
  Macropinocytosis
   Phospholipase C
    106668013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y EF-hand_like PLC-beta_C
Motif
Other DBs
NCBI-GeneID: 106668013
NCBI-ProteinID: XP_014251860
LinkDB All DBs
Position
Unknown
AA seq 1208 aa AA seqDB search
MTNAAKAPLAVQLKTLDVPKCMVDGEKVIKWDEDSGVGTPVTLRVDKNGFYLYWLDQNKE
MDLLDIATIRDCRTGKQAKIPKDPKLRLNVTMGSSQDLLEDKTVTLCHGSDFVNLTFINF
CCTKKETAQLWTDELLKLAFNLSQLNGSVMKFLLKAHTKLQLSVDKSSKIPIKNIIKMFT
QNKEDRKRVKTALESAGISTAKDEVISPEKFSFEEFFNFYKHLTQRTEAEKIFEELCGSK
KKLMSASQLVEFLNLTQRDPRLNEILHPYANVARAKDIIAQYEINKNNVNKGQLSFEGFL
RYMMSEDNPIVAPSKVELCDDMDQPLAHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAG
CRCVELDFWNGGRTEEPVIVHGYTFVPEIPAKDVIEAIAESAFKTSDYPVILSFENHCNP
RQQAKIAQYCRDIFGDMLLDSPLDSHKLEAGVPLPPPSLLKRKIIIKNKKKHHHNKVLER
GTTGEIEVVATGNGDVPHAAPVRQSSKESADEKPEEKNDEATDENVPAEDDLESSSGDED
EKPLEKDDKVASAKETEAGAEISALVNYVQPVHFVSFEITEKKNRFYEMSSFDEKQATML
LKESPIEFVKYNKQQLSRVYPAGTRFDSSNFMPQVFWNAGCQLVALNYQTLDLAMQLNLG
IFEYNQRCGYLLKPEFMRRQDRRFDPFAESTVDGIIAGTVSINVISGQFLTDKRCGTYVE
VDMYGLPADTVRKKFRTKIVPNNGINPVYDEEPFVFKKVVLPELACIRITAYEEGGKFIG
HRVLPVIGLCPGYRHVTLRTECGQPLQLATLFLHVVVKDYVPEGFSDFAEALANPIKYQS
ELDKRAQQLAVLTDLEESQDVWPSTEQEEGGNQSDEGGPPPAPRLKRIGSMCPEMSGGAT
GHNPAHRASIAVAPLPTTMEEPQPVTSPEVIHVSPPRVTTQTTTNFLEDMIADPVESFLE
SKSVKEKRLELEKKLEALRKKQDKERMRLASADSDKPRTKFYMSNKLVKRLSSKNMYYCF
RDTSGTPEGDGEGGGDGEVVNRGIPRSHSERMLAIFRDHITQERELVEKYHEQVFANAQK
VMQASQSQQLKMLHVLLERETSDVMRRLQNSRKQEVKALAKQHRDRDELVRMKREVASAM
VEKGVHERVRLTQIYEKKREELERQHNEVKNQLTNEKAKAKNALIKELEKKSQRIEQEIE
LEPRSSER
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgccgcgaaggccccgttggcggtccagttgaaaactctcgacgtacctaaa
tgcatggtcgatggagaaaaagtcataaaatgggacgaggattcaggtgttgggactcca
gttacactgcgggtcgacaaaaatggattttatctctattggctggaccagaacaaggaa
atggatttgcttgatattgctactattagagactgtaggactggaaaacaagctaaaata
ccaaaggatcctaagctcagacttaacgtcacgatgggctcttctcaggacttactggag
gataagactgttactttatgtcatggttcggattttgtgaacttaacatttattaatttc
tgttgcacaaaaaaggaaactgcacaattatggacggatgaattattaaaattggcattt
aacttatctcaactgaatggatctgttatgaaatttttgctcaaggcgcatacaaaattg
cagctgagtgtagataagtcatcaaaaattcctatcaaaaatataatcaaaatgttcaca
caaaataaagaggacaggaagagagtgaaaactgctctcgaatcggcgggaatatcgacg
gcaaaggatgaggtgatatcaccggaaaagttttcatttgaggagtttttcaatttctac
aaacacttgacccagaggactgaagcagagaaaatatttgaagaattgtgtgggtcgaag
aagaagttaatgtctgcatctcagttggtagaatttttgaatttaactcagagagatcca
aggttgaatgaaatattacatccgtatgcgaatgtagcaagggcaaaagacataatcgcc
caatatgaaataaacaaaaacaatgtcaataagggtcaattgagttttgaaggttttctg
aggtacatgatgagtgaagacaatcctatagttgctccttctaaagttgaactttgtgat
gatatggatcaacctctcgcacattattttatcaattcttcgcataatacctatttgact
ggtcatcagttaacggggaagtcgtcggttgaaatttatcgccagtgtcttttggctggt
tgtcgttgtgtcgaactagatttttggaatggtgggaggacggaagagcctgtcattgtt
cacggatatacatttgtacctgaaatcccagctaaagacgtgatcgaagcaatagcggag
tctgcgttcaagacatccgattatccagtcatactttcttttgagaaccactgcaacccg
aggcaacaagcgaaaatagcgcagtactgcagggacattttcggtgatatgcttttagat
tcacctttagattctcacaagcttgaggcgggagttccacttcctccgccttctttgctg
aagcgtaagataatcattaaaaataagaaaaagcaccatcacaacaaagtattagaaagg
gggacaaccggagaaattgaagtagttgcgacgggaaatggcgatgtccctcatgcagct
cctgtcaggcagagcagtaaagaaagcgcagatgaaaaacctgaagaaaaaaacgatgaa
gccactgatgaaaatgttccagctgaggatgatttagaaagctcaagtggggatgaggat
gaaaaaccattggagaaagatgataaagtggcctctgccaaggaaactgaagcgggagct
gaaatttctgcccttgttaattacgttcaacctgttcattttgtttcatttgaaataaca
gaaaaaaaaaataggttttatgaaatgagttcttttgatgaaaaacaagctacaatgctt
ttaaaagaaagcccgatagaatttgtaaaatacaacaaacaacaactaagccgagtttat
ccggctgggacaaggttcgattcttcaaatttcatgcctcaagtattttggaatgctggt
tgtcaactggtcgctctaaattatcaaactctcgatcttgcaatgcaattaaatttgggt
atttttgaatacaaccaaagatgtggatacctcttgaaacctgaatttatgagacgtcaa
gatcgtaggtttgatccatttgctgaatcaaccgttgacggaattattgccggcaccgtc
tcaatcaatgtcatatccggccagtttttaacggataaaagatgcggaacgtacgtagag
gtcgatatgtacgggcttccggctgacacggtcaggaaaaagttcaggaccaaaattgtt
ccaaataacgggattaatcccgtgtacgatgaggaaccttttgtcttcaagaaggtggtg
cttccagaattggcttgcattagaataacagcttatgaggaaggaggaaaattcattgga
cacagagttctccctgttataggactttgtcctggttatcgccatgtaacgttgagaaca
gaatgtggacaacctttacaactcgcgactctcttcctccatgtcgtggtcaaagattac
gtaccagaaggcttctcagactttgccgaagctcttgccaatccgattaaataccagagc
gagctagacaagagggcccaacagcttgctgtactcacagacttagaagaatctcaggat
gtttggcccagtacagaacaggaggaggggggaaatcagagtgatgaaggtggccctcca
ccggctccgaggctcaaacgaataggatcaatgtgccctgaaatgtcaggaggagctacc
gggcacaatcctgctcaccgagcatccatcgcggtagcaccactcccaactacaatggaa
gagcctcaacctgtaacttcgccagaagtaatacacgtcagcccaccaagagtcaccacc
caaacaaccactaattttcttgaagatatgatcgctgatcctgtagagtctttcttggaa
agcaaatctgttaaagaaaaacgactcgaattagagaaaaaacttgaagcgttgcggaaa
aaacaagacaaggaaaggatgcgcttggcttcggcggattcagataagcccaggactaag
ttttatatgagcaataaattggtgaaacggctctctagcaaaaacatgtattattgtttt
agggatactagcggtacacctgaaggagacggtgagggtggcggtgacggtgaagtcgtg
aatcgagggataccacgaagccattcggaaaggatgctcgcaattttccgtgatcacatc
actcaagagcgagagcttgttgaaaagtatcacgagcaggtttttgccaatgcacaaaaa
gtcatgcaggcatcacagtcacaacagctgaaaatgctccacgtcctcctcgaacgagaa
acaagtgatgtcatgcgaaggctgcagaactcgaggaagcaagaagtaaaagctctggct
aagcaacaccgagacagagatgaactcgtcaggatgaagagagaagtcgctagtgccatg
gtagaaaaaggcgtacacgaaagggtaaggctgacacagatatatgagaaaaaacgagaa
gaattggaaaggcagcacaatgaagttaagaatcagctaactaacgagaaggccaaagcc
aaaaatgctttaattaaagaacttgaaaagaaaagtcagcgaatagagcaagaaattgaa
ttagaaccacgatcgagcgaacgctga

DBGET integrated database retrieval system