KEGG   Cimex lectularius (bed bug): 106668275Help
Entry
106668275         CDS       T05603                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00480  Glutathione metabolism
clec00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106668275
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106668275
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     106668275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 106668275
NCBI-ProteinID: XP_014252364
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MTVEHLAAGSKAVPLQEGKLRLYSMRFCPYAQRAHLILNAKNIPHDTVYINLKNKPEWYL
EQFPLGKVPAICVDGDRIYESLIICDFLDEKYPENPMYPKDPLKKAKDRILIERFSKVSS
LLYQCYLNPNMDVQLLHPVFDAMDHFEKELRKRGTPFYSGSKPGMVDYMIWPWCERLEML
RVIGGDNFKVPKDRFAKLWRWSEAMLEDDAVKKHYVTPEQHAKYLQSHRAGTPDFDNIL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgaacatctcgccgcaggatccaaggccgtgcctcttcaagaaggaaagcta
cgtttgtattccatgcgcttttgcccctacgcccagcgagctcacctcattctcaacgcc
aagaacattccccatgacacagtttatatcaatctgaaaaataaaccagaatggtatctc
gagcagtttcctcttggaaaagtgcctgctatttgtgtcgacggcgatcgcatctacgag
agtttgataatctgcgacttccttgacgagaagtacccggaaaacccgatgtatccgaag
gatcctctcaaaaaagctaaagaccgcattttgatcgaacgtttcagcaaggtcagtagt
ttgctttaccagtgctatttaaatccaaatatggatgttcaattgctacaccctgtgttc
gatgctatggaccactttgagaaggaacttagaaaacgggggacaccgttctattcagga
agcaaaccgggcatggttgactacatgatttggccctggtgcgaaagactcgaaatgcta
agagtgatcggaggtgataacttcaaagtgcctaaggatagatttgcaaagctttggcgg
tggtctgaagcaatgttggaagatgatgctgttaagaaacattatgtcacacccgagcag
catgccaaatatctccagtcacacagagcaggaactcccgattttgacaatattctctaa

DBGET integrated database retrieval system