KEGG   Cimex lectularius (bed bug): 106668813Help
Entry
106668813         CDS       T05603                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00020  Citrate cycle (TCA cycle)
clec00190  Oxidative phosphorylation
clec01100  Metabolic pathways
clec01200  Carbon metabolism
Module
clec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
clec_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106668813
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106668813
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106668813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like DivIVA
Motif
Other DBs
NCBI-GeneID: 106668813
NCBI-ProteinID: XP_014253429
LinkDB All DBs
Position
Unknown
AA seq 654 aa AA seqDB search
MAYNVQGSRYLKMWNALRRVLFSSSKQIHITPNPGTTSKSTIKKELTVIDHVYDAVVVGA
GGAGLRAGFGLVSKGYKTAVITKLYPTRSHTVAAQGGINAALGNIEKDHWAWHMYDTTKG
SDWLGDQDSIHLLTREAPQVVIELENYGVPFSRTEDGRIYQRAFGGQSLEFGKGGQAHRT
CAVADRTGHALLHTLYGQSLRYDCNYFVEYFALDLLMDGDKCCGVLALNIEDGSLHRFFC
NSTVLATGGFARCYFSCTAAHTCTGDGPAMFARAKLPLQDMEFVQFHPTGIYGMGCLITE
GSRGEGGYLVNSQNEAFMVKYAPTAKDLASRDVVSRAITIEIKEGRGVGPLKDHIYLKLH
HLPAEKIASRLPGISETAMLFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGQALTRKGDND
AIIKGLYAAGENASCGVHGANRLGANSLLELVVFGKVVACTIAEETKPGDLPCKPDKAGE
ESIEELEKIRASDGSLSVGQIRMKMQRVMQQYAAVFRTEETLKKGIKELDEVFESVKNLK
ICDKSLAWNSDVIEALELHNLLICAKNIIVSAESRKESRGAHARDDFKVRVDEYDYSKPL
EGQMKKPMKDHFRKHTLSYYNPATKEVSIQYRPVIDDTLDPDEVKTVPPAIRKY
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcgtataatgttcaaggatcacgttatttgaagatgtggaatgcacttcgtagggta
cttttttcaagctctaagcaaatacacataacacctaacccaggtacaacttcaaaaagt
acgataaaaaaggaattgacagtcatagatcatgtctacgatgctgtcgttgtcggtgct
ggaggggcaggcctaagggctggattcggcttggtctccaaaggctataaaaccgcagtg
atcacgaaactttatccgacacgatcgcacacagtcgcagctcagggcggtatcaatgca
gctttaggcaatatagaaaaggaccattgggcctggcatatgtacgatacgacaaaaggt
tctgactggcttggagatcaagactccatccatcttctaacgagagaagcacctcaagtt
gttattgagctagaaaactatggagttcctttctcaagaactgaggatggcagaatatac
caaagggccttcggagggcaaagtctggaatttggcaaagggggccaggcgcacagaact
tgtgcggtagctgatagaactgggcatgctttgttgcacacactgtacggccagtctctg
agatacgactgcaattattttgttgagtactttgcactcgatctgttgatggacggtgat
aaatgttgtggcgtgcttgcccttaacattgaggatggctctctccatagatttttctgt
aatagtactgtattggcaactgggggctttgcgaggtgttacttttcttgtactgcagcc
cacacttgcactggcgacgggcctgcgatgtttgccagagctaaacttccacttcaagac
atggaatttgtacagttccatccaacaggaatttatggcatgggatgcctcataactgaa
ggaagtcggggagaaggaggatatttggtaaacagccaaaatgaggcatttatggtaaaa
tatgcaccaacggctaaagatcttgcatcaagggatgtcgtgtcaagagcaataactata
gaaataaaagaaggaagaggagtaggccctctaaaagaccatatttatcttaagctacac
cacttgcctgctgagaaaatagcaagtcgcctaccaggtatttcagaaacggcgatgctc
tttgccggtgtggatgtgaccaaagagcccattcctgtcataccaacggttcattacaat
atgggaggcattccgactaattacaaaggacaagctctcactcggaaaggcgacaatgat
gcaatcattaaaggtctctatgctgcgggagaaaatgctagctgtggtgtccacggcgca
aaccgattaggtgccaattcattattggaacttgtagtttttggtaaagtcgttgcttgc
acaattgccgaggaaactaaaccaggtgatctgccttgtaaacctgataaagcaggtgaa
gaatctattgaagaattggagaagatccgtgcttcggatggatcactcagcgtgggtcaa
ataagaatgaaaatgcaaagagtaatgcagcaatacgctgctgtattcagaacggaagaa
actctgaagaaaggaatcaaagaactcgacgaagtgttcgaatcagtaaaaaatttaaaa
atatgtgataagtcgcttgcgtggaattcagatgttatagaagctttagaacttcacaat
ctgttaatatgtgccaaaaacattattgtaagcgctgaaagcagaaaagaatctcgagga
gcccatgctagagatgattttaaagtaagggtcgatgaatatgactatagtaaaccgctt
gaaggccagatgaaaaaaccaatgaaagaccactttagaaaacacacgttgagttattac
aatccagcaacaaaagaggtgagcattcaatacaggcctgttatagatgatactctcgac
ccggacgaggtgaagacagttcctccagcaattagaaaatattaa

DBGET integrated database retrieval system