KEGG   Cimex lectularius (bed bug): 106669526
Entry
106669526         CDS       T05603                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
clec  Cimex lectularius (bed bug)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:clec04052]
    106669526
   00536 Glycosaminoglycan binding proteins [BR:clec00536]
    106669526
Cytokines and growth factors [BR:clec04052]
 Growth factors
  Growth factors (RTK binding)
   106669526
Glycosaminoglycan binding proteins [BR:clec00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106669526
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 106669526
NCBI-ProteinID: XP_014254541
LinkDB
Position
Unknown
AA seq 158 aa
MGGNSAKQKKPEPEHCEHQPAPKQHYGKRKQLYCRTGYFLAIMQDGTVAGIDEDMHPNAI
VEFTTVKAGEVRIRGTKANLYLAMNKTGRLYGEANVLDESTVFLESLHRHHLVYLSKPYA
RFNWYVALKKNGKPKDAKKTKLGQKAIQFLTVKLLEDR
NT seq 477 nt   +upstreamnt  +downstreamnt
atgggagggaactctgcaaagcagaaaaagcccgaacctgagcattgtgagcatcagccg
gctcctaagcaacactacgggaagagaaagcagctgtactgccggactggctatttcctt
gcaatcatgcaagatgggacagtcgccgggattgatgaagacatgcatccgaacgccatc
gttgaattcacgactgtaaaagcgggcgaggtgcgcatcagaggtacgaaggcgaatctt
tacttggcgatgaataaaaccggccggctttacggagaagcaaacgtattggacgagtcg
actgtgtttttagaatcgcttcacaggcaccacctcgtctacctttcaaaaccatacgcc
cgcttcaattggtacgtcgcgcttaagaaaaacggcaaaccgaaggatgccaaaaagacc
aagctgggacaaaaggcgatccagttcctcacagtcaaactcttggaggacagatag

DBGET integrated database retrieval system