KEGG   Cimex lectularius (bed bug): 106670646
Entry
106670646         CDS       T05603                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00230  Purine metabolism
clec01100  Metabolic pathways
clec04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106670646
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106670646
Enzymes [BR:clec01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106670646
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 106670646
NCBI-ProteinID: XP_014256648
LinkDB
Position
Unknown
AA seq 999 aa
MHLQALYRAYSVKQRRPYLKCFVITSLLYDIYCLIIPFEQELLNRGVTTFFLAANLCLLF
VSLRARRRFVWTTIPHIAWQAANFQILARMFLLEDLTPRDDLGWILVLEYLIYVTLPLSI
KYCLVLAAGTFATYIVCLFGLVKQDENRDYQIFANIVLMFGANLLGLTSSYLEDIQQKKA
FLDTKQCLEMKLVIEEQSAEQERLLLSVLPEHVAVKMRQDLGSALDTQFKKIYMSRHENV
SILYADIVGFTAISSTYSASELVKILNELFARFDRLSEKYEQLRIKILGDCYYCISGAPR
ERPDHAVLSIHMGLSMVKAIKYVQQKTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKD
VELANKMESSGLPGKVHISEKTLNFLNGEFDVEPAFGEKREESLRLAGLKTYFITKVNKP
FKGQVINNGTLHEDTMDDMDDIGDIATPVEEPANAKDRENTDDFRQRLRKDLMSRTGWRS
VVNHIHCITLRFRDQQKEESYKNNAESFSSIALVGCPLAIITIGLARTIVLPSDIRSLII
YGNTAWILLFLTVFAIADPFPRFFPKAVVLLSKKSNQSMLGRSILAVSCIVLLGLGHITD
MFTCNPPYISKEANCTQLIFSEECLYPSYYLHMMVLVLIAAILPVQPLIVIKINILLILV
CIALLVHFFVVSRPLFRKDDLSYFPADLATRIMLVMVSWGLMSLAKVMEFGSRVLFLWKS
EAEEQREMASDIRRRNEALVYNILPPHVAAHFLGNKKRQHEELYSQSYSEVGVLFASMPN
FSDFYSEESVNNQGLECLRFLNEVISDFDALLELQKFQDVIKIKTIGSTYMAASGLNPST
TTVKDDSITGKWSHLALLVEFAFELKKALQCINEQSFNHFVLKMGINHGPITAGVIGARK
PHYDIWGNTVNVASRMESTGKAGYIQVTEETSEILRNFGYVFEQRGLVAVKGKGQLMTYY
LVGKGTDIVLNTVQPSVVGTELPEIAEETEPNDQAALLS
NT seq 3000 nt   +upstreamnt  +downstreamnt
atgcacctgcaggccctgtacagagcgtacagcgtcaagcagcgccggccgtacctcaag
tgttttgtcatcacgtcccttctctacgacatatactgtctcatcatccctttcgagcag
gagcttctcaaccggggagtgactacgtttttcttggcggctaacctgtgcctcctgttc
gtgtcgctgcgggccaggagaaggttcgtatggacgaccataccgcacatagcctggcag
gcggctaacttccagatcttggccaggatgttcctgctagaagacctcactccgagggac
gacctaggttggatccttgtacttgagtacctcatatatgtcaccttgcccctcagcatt
aaatactgcctcgtcttggccgcaggcaccttcgccacctacatcgtctgtcttttcggc
ctcgtcaagcaagatgaaaaccgtgattatcagatttttgctaacatcgtgcttatgttt
ggggcgaacttgctcggtctcacgtcctcttatttggaggacatccagcaaaagaaagcg
ttcctggatacgaagcagtgcctggagatgaagttggtcatagaggaacagtcggctgaa
caagaaaggctgttgctgtctgtccttccagagcacgtcgctgtgaagatgcggcaggat
ctgggctctgcactagatacgcagtttaagaaaatttacatgagcagacatgaaaacgtc
agtatactttacgctgacatcgtcggcttcacagcaatttcatcaacctattcggcctca
gaactggtgaaaattttgaacgagcttttcgcaaggttcgaccgtctttcagaaaaatat
gaacaactaaggataaaaattctcggcgactgctactactgcataagcggagctccgaga
gaaaggccagatcatgccgtcctttcgatccacatggggctctccatggtcaaagcaata
aagtatgttcagcaaaagaccaattctcctgttgacatgagggtaggaattcacacagga
gcggttctcgccggtgtcctcggtcagaggcagtggcagttcgacgtctactcaaaagac
gtcgaactagcgaataaaatggaatcgagtggtcttccaggaaaagtacacatatcagag
aagacgctgaacttcctaaatggcgagttcgacgtggagccggctttcggcgaaaaaaga
gaagaaagtttgagattggccggcctcaagacgtatttcataactaaagtcaataaacct
ttcaaaggacaggtcataaataacgggaccctacacgaagataccatggacgacatggac
gacatcggggatatcgccacaccggtggaagaaccggcgaatgctaaagatcgcgagaac
acagacgatttccgccagcgattgcgaaaagacctgatgagcagaactggctggagatcc
gtcgtcaatcacattcactgcatcacgcttcgcttcagggaccagcagaaggaggaaagc
tacaagaacaacgccgaaagcttcagcagtatagcgcttgtcggatgcccgttggcgata
atcaccatcggcctcgcaaggacaattgttctacctagcgatattagaagtctaattatt
tacggcaatacagcctggattcttctctttttaaccgtttttgctatagctgatccattc
ccaaggttctttcctaaagcagtagtgttattgagtaaaaaatcaaatcagtccatgctc
ggacggagtattctggcggtgagctgtattgttctccttggactgggtcatataacagac
atgtttacatgcaacccgccatacataagcaaagaagccaactgtacgcagctaatcttc
agtgaagaatgcctctatcctagttactatcttcatatgatggtgctagttttaatagct
gcaattcttccagtccagccactcatcgttatcaaaatcaacattctacttattttagtt
tgcatagctcttttggtgcacttttttgtagtgtctaggcctctatttaggaaagatgac
cttagttattttcctgcggacttagctactcgaatcatgctcgtaatggtctcttgggga
ttaatgtcactggccaaagtgatggaattcggctcaagagttttgttcctatggaagagt
gaagcagaagaacagagagaaatggcaagtgacatcaggaggaggaacgaggcgcttgtc
tacaacatcctacctccacatgtggcagcgcacttcctgggcaacaaaaaacggcagcat
gaagaactctactcacaaagttactccgaagttggagtgctttttgcatctatgccaaat
ttctctgatttctattctgaagaatcggtgaacaatcagggtctggagtgtttgcgattt
ttgaatgaggtcatttcagattttgacgcactcctggagcttcaaaagtttcaagatgtc
ataaagattaaaacaattggctcgacatacatggcagcaagtggtttgaatccctcaacg
acgacagtaaaggatgattctatcactgggaagtggtctcaccttgcccttcttgttgaa
tttgcttttgaactgaaaaaggcactacagtgtatcaatgagcagagctttaatcacttt
gttcttaaaatgggtatcaaccatgggcctataactgcaggtgtgattggtgctaggaag
ccccattatgatatttggggcaacaccgtcaacgttgcatccagaatggaaagtactgga
aaagccggttacatacaggtgacagaagaaaccagtgaaatcctacgcaacttcggctat
gtcttcgaacagaggggcctcgttgcggtgaaaggcaaaggccaactgatgacctactac
ctcgtgggcaaaggcactgacattgtgctcaatactgtccagccgtctgtagtgggcaca
gaactgcctgaaattgctgaagagactgagccaaatgaccaagcagcactcttgtcctaa

DBGET integrated database retrieval system