KEGG   Cimex lectularius (bed bug): 106672504Help
Entry
106672504         CDS       T05603                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] isoform X1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec04146  Peroxisome
clec04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:clec00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106672504
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106672504
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106672504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD Big_2
Motif
Other DBs
NCBI-GeneID: 106672504
NCBI-ProteinID: XP_014259499
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MSMKAVCVLSGETVKGTVFFEQKSPDSEVTVTGELTGLSKGLHGFHIHEFGDNTNGCTSA
GPHFNPKNKEHGAPTDEVRHIGDLGNVTAGADGKAKVSLTDKYISLCGPMSIVGRTVVVH
ADPDDLGKGGHELSKSTGNAGARLACGVVGITKA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgaaagccgtatgcgtactcagcggtgagaccgtcaaagggaccgtgtttttc
gaacaaaaatcgccagattccgaggtgacggtcaccggcgagttgaccggcctctcgaaa
ggcctccacggttttcacatccacgaattcggcgacaacacaaacggttgcacaagtgct
ggtcctcattttaaccccaagaacaaagaacacggtgcccctactgatgaagttcgccac
atcggtgatcttgggaacgtgactgccggtgctgatggaaaggccaaggtttccttaacc
gacaaatacatttcactctgcgggccaatgagcatcgtcggaagaacagtcgttgtgcac
gccgatccggacgatcttggaaaaggagggcacgagttgagcaaatcaactggaaacgct
ggagcccgattggcctgtggagtggtcggaataacaaaagcatga

DBGET integrated database retrieval system