KEGG   Cimex lectularius (bed bug): 106674386Help
Entry
106674386         CDS       T05603                                 

Definition
(RefSeq) F-actin-monooxygenase Mical isoform X1
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
clec  Cimex lectularius (bed bug)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clec04131]
    106674386
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     106674386
Membrane trafficking [BR:clec04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    106674386
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    106674386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM Pyr_redox_3 Pyr_redox_2 CH_2 FAD_binding_2 HI0933_like FAD_binding_3 Pyr_redox NAD_binding_8 DAO AlaDh_PNT_C FAD_oxidored Lycopene_cycl NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 106674386
NCBI-ProteinID: XP_014262535
LinkDB All DBs
Position
Unknown
AA seq 2201 aa AA seqDB search
MERSENVALAAQVFDQFCNAGTLKAILALHRHLCDLLQIRPTNFNQFYPKLKAKLGSWRA
QALWSKFDKRASHKCYNRNKCGTNLRVLVIGAGPCGLRTAIEAQLLGAKVVVIEKRDRIT
RNNVLHLWPFVIHDLRALGAKKFFGRFCAGAIDHISIRQLQCILLKVALILGVEVHEAVG
FEKLLPPPDVQGEERVGWRAQTSPPDHPASQYEFDVLIGADGKRNTLDGFKRKEFRGKLA
IAITANFINRHTEAEARVEEISGVAFIFNQKFFKDLYASTGIDLENIVYYKDDTHYFVMT
AKKHSLIDKGVILSDQSDAAKLLSTDNVDKKALLEYAREAADFSTGCRLPQLEFAVNHYG
QPDVAMFDFTSMYAAENATHFIEKRGHRLMVALVGDSLLEPFWPTGSGCARGFLSCMDTC
WAIRSWGLGLHPLEVIAERESIYRLLAQTTPENLQRDLQSYTLDPHTRYPNLNSRSLLPL
QVRSLFETDDISAVEQFLKEPRNRADTRAVTDTPKKRKRKEGLVHPDTLLYWLQKQVALY
NTVKLLDMTSSFKDGMALCAIIHRYRPHLVDFNSLNKEDISKNNQLAFDILEKEFAIPPV
MTGDEMAECEIPDKLAMLSYLSQVYEAFRGEIPHIKHPKLEENEENVEEVVKLHSTRMKS
LAHMTSQQKVNLLAKATHRPPRRRRSHLSTTESIEERLKKLEALEEEANCLKRDFEPVIG
GTQFTERQERIRELERERRHRQRRQEEIERNRNDRYMRRKYLRHLANQQFYKSMQMLQSN
QRPDDESGPFEDYSLFVYRMTAPDFKDRVKQLEDKLLYPDRENRSMDYSQKGSSTDKEFS
GRVKDLEAKLRGVHSDKKPKDLLRAIGKIEKGDWNVKQIEQKIEENRMGRGGGKKYEKVP
KWSKQQFEDKVSAVERKLKAKSNKIDFDNKYSELDNNMMKIGRKIKEGIYLEQGQRGANK
VSAMAAHLATIHRQPEPAVTHVSKSSSGIVLPTQGASEMCHFCNKRVYLMERLNAEGKFF
HRGCFRCQYCSTSLRLGNYAFDREGKFGYKFYCVQHFGLQGTTKRSATREEFKQQPTSKK
PPVVPIQTKEEQPIDDISTPERAEFENLSDCVEVEEDEWTDRNFGLSTTDVSDTSADSDS
SSDENDGFAEAEDGGLDPEETLRLVKDWTRRYAYSSDSQDESETEMEDDGDLKKSDQLDD
DSESGSETEVQSDDYSSVSSAGDNSATEISTDSEFEHDGTTHTIPDIVISETVQVKRGNI
EQPKQVQIVTRQLNGKIQTTNNDLKQNATRETKPALNNLVNNNRPSPLINPNRGDYLLNR
TQSTEGIASKISLELKKKYLLGPTGLSGSVKKSGSATTLDTRFKSLIDQISEQQKLLNPA
PAPSPTMQAFLQGADKLKTSPVHLLEKKQLPSDNFKHICSLKENEDRKDDKKEDDQSGTR
SPVHETSIVVPEFPRTEVTKEVESDSLSSDLSSSTEDSADEQPIQSPPKLEIHNSRGELM
EDTPEMDSLNMPDICLAGNDPSPIDKLDLVPLEFKKVITVPTDTAGGEVLTQVPNTAELY
ADKEDSRPNSPDSTDSLKNDVTAMTETEFSDWARDEDGVSEPLDDMEFINPQYQKQAAVP
RGIAKIAKTEDFDEYTHVCGKDSPLNLDNLEFMDTGEESSDESSTNNKLLLNKGYVQFVN
NEDDLTPVIEAVNPLKEELTDTTTTTSEVTTIKDSPADKDFDYVPFQSNKKPFVNLRDSI
DIMKMREPEPKGNSLNSPATSRKLEQLSQERAKQKDLIHEMVMNKLLAQGKSPQERKKRV
RNFSPHSAPPLEHTTPILETKKLEESPKTPLAVSTPKTPINQIFRPRQRANTVGNGWRTE
MRIPEASSLPDIHNACTGFKTPLTIPNLRSGLREQARAKFKMMSDEELGLSPEDKLRKFK
LKIQKHLPDTPKSSQTNEKMSSLKKTKDDRKKSIIQAVSDFFHKKSPSPPKTPSSQSPTT
HFNINLRRDKQSDAPPVPPPPQSYMPSQEDSFSEEETHSGDNTSLIKKQRISRRIARQAQ
SKRLRMAQEVQRQLEELEVKQKELEAQGVAVEKALRGEETAGVTGSESELLGEWLRLTRE
RSEARSKEKMLVIRGQEIELEHRHARLQAQLTSLMDQNHDGKKTSEEVALEGRILREMLE
IAERKNSLQLQLQAETQRFQEEDRDLEAKMKAKGLQLPLKQ
NT seq 6606 nt NT seq  +upstreamnt  +downstreamnt
atggagagatccgagaatgtagcattggctgctcaagtatttgatcaattttgcaatgca
ggaacgctaaaggctattctagctctccataggcatctttgcgacctccttcagatccga
cctacaaacttcaaccagttctaccccaaactcaaggctaagttaggatcatggcgggct
caagctctgtggagcaagtttgataaaagggcaagtcacaagtgttacaacagaaacaaa
tgcggtacaaatttaagggttctggtaataggagctggaccatgcggattaaggactgcg
atcgaagcccagctgctgggtgcaaaggtggtagtcatagaaaaaagagaccgcatcaca
cgcaacaatgtgttgcacctctggccttttgttattcacgatctaagggcgcttggcgca
aagaagttctttgggaggttctgtgcaggagccatcgaccacatcagcatccgacagcta
cagtgcatccttctcaaagtggctttgattttaggagtggaagtgcatgaagctgtcggt
tttgaaaagctcctccctcctcctgatgtccaaggcgaagaaagagtcggatggagagca
cagacaagcccacctgatcatccagcatcacaatatgagtttgatgttctaataggagca
gatggaaagcgaaacacacttgatggttttaaaagaaaagaatttagaggtaaattagct
atcgctataacagcaaatttcattaaccgacatacagaagctgaagcaagagtagaagaa
ataagtggtgtagcttttatattcaaccaaaaatttttcaaagatctgtacgcatccact
ggcattgacctagagaacatcgtttactacaaggatgacacccattattttgttatgact
gctaaaaaacatagtcttattgataaaggtgtaattctttcggatcagagtgatgctgca
aaattattaagcacggataatgttgacaagaaggccctgttagagtacgctcgcgaggca
gcggatttttcaacaggatgcagacttccccaattggaattcgctgtgaaccattatggg
cagcctgatgtggcaatgttcgactttacatcgatgtacgctgctgaaaatgccacacat
tttatagaaaagcgtggccaccgtctgatggtcgcgcttgtcggtgacagccttctggaa
ccgttctggcctacgggatcagggtgtgctaggggatttttatcgtgcatggatacgtgt
tgggcaatacgaagctggggcctcggccttcatcctttggaagtgatagctgagagggaa
agcatttacaggctgctggcacagactactcccgagaacctccaaagagacttacaatcc
tatacattggatccacatactagatatcctaatcttaactcaaggagtttgctaccatta
caagtcagaagcctatttgaaactgatgacatttcagctgtggaacagtttcttaaagag
ccaaggaatcgtgctgacacccgtgctgttacagacactccaaagaagagaaagagaaaa
gaaggccttgttcatcccgatacacttctctactggcttcaaaagcaagttgctttatac
aacactgtaaaactattagacatgacctcatcttttaaggatggcatggcactctgtgcc
attatccaccggtataggccgcatcttgtagatttcaattccttgaataaagaagatatt
tcaaaaaacaaccaactggcttttgacatattagaaaaggaatttgccatacctccagtg
atgacgggtgatgagatggctgagtgtgaaattcctgacaagctggctatgctttcatac
ctctctcaagtgtatgaagctttcaggggtgaaataccgcacatcaaacatccaaaactg
gaagaaaatgaggaaaacgtagaagaggtagtcaaactgcattcgacaagaatgaaatct
ctggcccatatgacatcacaacagaaagtaaatcttttggcgaaagccacccataggcca
ccacgaaggagaaggagccatttgagtacaacggaaagtatagaagagaggctcaagaag
ttagaagcgttggaagaagaggctaattgtttgaaaagagattttgagcctgtaataggc
gggacgcagtttaccgagaggcaggagaggattcgtgagctagagagggaacggaggcat
aggcagaggcgtcaggaggaaatcgagagaaaccgaaacgaccggtacatgagaagaaag
tacctcaggcatctggcaaatcagcagttctacaaaagtatgcaaatgctccagtcgaac
cagaggccggatgacgagtccggcccgttcgaagattattcccttttcgtgtacagaatg
acagcacccgatttcaaagatagggtgaaacaattggaagacaagcttctttacccagat
cgggagaacagatcaatggattattcgcaaaagggctcttcgactgacaaagaattcagt
ggtagagtcaaggacctggaggcaaagcttagaggagtacattctgacaaaaagccaaaa
gatcttctcagagccataggtaaaatagaaaaaggcgattggaatgtaaagcagatagag
caaaaaatagaagaaaacagaatgggaagaggagggggaaagaaatatgaaaaagtgcca
aaatggagtaagcaacaatttgaggataaagtttctgcagtggaacgaaaactaaaagcc
aaaagtaataaaatagattttgataataagtatagtgagttagacaataatatgatgaag
atcggtcgaaagatcaaagaaggtatttacttggaacaaggacagcggggtgcaaacaaa
gtatcagcgatggccgctcatctagctacaatacatcgccagcccgaacctgctgtcact
catgttagtaagagttcaagtggtatagttctaccgacacagggtgctagtgaaatgtgt
catttttgcaacaaacgagtctaccttatggaaaggcttaacgcagaagggaaatttttc
catcgaggttgtttcaggtgccaatattgttctacttcccttcggctaggaaattatgcg
ttcgatcgagaaggtaaatttgggtataaattttactgtgttcaacattttggtctccaa
ggtacaacgaagaggagtgcgacgagggaagagtttaaacaacagccgacctctaagaaa
cctcctgtggttccgattcaaaccaaagaagaacaacccatagatgatatcagtactcct
gaaagggctgaatttgaaaacctgtcggactgcgttgaagtcgaggaagatgaatggacc
gacaggaatttcggcctgtccactacagacgtctctgatacttcggcagacagtgatagt
tcgagtgatgaaaatgatggatttgctgaagcggaagatggaggtctcgatccagaagaa
actctcaggctggtcaaggactggacaaggagatacgcctactcttcggactcacaagat
gaaagcgagacagaaatggaagacgatggagatttgaagaaaagcgaccaattagatgat
gatagcgagtcgggctcggaaacggaggtacaatctgatgattatagtagtgttagttca
gctggtgacaattcggcgactgaaatttcaacagattcagaatttgaacacgatggcaca
actcacactattcccgatattgtaattagtgaaactgttcaagttaaacgaggaaacatc
gaacaacctaaacaggtacaaatagtaacaagacaactcaatggaaaaattcaaacgaca
aacaacgatttaaaacaaaatgcaacaagagaaacaaagccggctttgaataatttagta
aataacaataggccatctccactcattaaccccaaccgaggagattatctgttaaacaga
actcagtccactgaaggaatcgcttcaaaaatatcattggaattaaaaaagaaatattta
ttaggaccgacgggattatcgggcagtgttaaaaaatccggatctgctacaactttagat
acaagatttaaatcgctcatagaccagatttcagaacaacagaagttattaaaccctgct
cctgcaccgagtcctactatgcaagccttcttgcaaggtgcagataaacttaagacatcc
ccggttcaccttctagagaaaaaacaattgccatccgataatttcaaacatatttgtagt
cttaaagaaaacgaagatcgtaaagatgacaagaaagaagacgatcagagtggaacgaga
agtccggttcacgagactagtatagttgtacccgaatttccaagaacggaagtcacaaag
gaggtcgaaagcgattccctctcttctgatttgagtagttcaactgaagacagcgctgat
gaacaacccattcaatctcctccaaaactggaaattcacaattcaagaggtgaactaatg
gaagatacacctgagatggatagtcttaacatgcctgatatttgtctagcagggaatgat
ccttccccaattgataaactagaccttgttcctttggaatttaagaaagttattactgtg
ccgactgacacagctggtggggaagttctgacacaggtgcccaacactgcagaactgtat
gctgataaagaagacagtaggcctaattccccagacagtactgatagcttgaagaacgat
gtaactgctatgacagagacggaattctccgattgggcaagggatgaggatggagtgtct
gagccactagatgatatggaattcattaatccacaataccaaaagcaggctgcagttccc
cgtggcattgctaaaatcgctaagactgaggattttgatgaatatacacatgtttgtggt
aaggacagcccattaaatctggacaacctggaattcatggatacaggcgaagaaagcagt
gatgaaagttctactaataataaacttttattaaataaaggttatgttcaatttgttaat
aatgaagatgatttaacccctgtcatcgaggctgtgaatccattaaaagaggagttaaca
gacactacaacaacgacatcggaagtgactacaattaaagatagcccagctgataaagat
tttgactatgttccctttcagagtaataaaaaaccattcgtaaatcttcgagattctata
gatataatgaagatgcgagagcctgaacctaaaggcaacagcttgaactcaccagcgact
tcaagaaaattagaacaattatctcaggaaagagcaaaacagaaagatctcattcatgaa
atggttatgaataaattactggctcagggaaaatcacctcaggaaaggaaaaaaagggtt
aggaacttcagtccccattccgctccacccttggaacacactactcccattttagaaaca
aaaaaactggaagaatcgcccaaaacaccgcttgctgtttccacgcccaaaacccccatc
aatcagatattcaggccaaggcaaagagcaaacaccgtcggaaatggctggagaactgaa
atgagaataccggaagcatcctccctacctgacatacataacgcttgtacagggttcaaa
acacccctcaccatacctaatttacgaagtggtctgagagaacaggcacgtgctaaattt
aagatgatgagcgatgaagaactgggcctctctccagaggacaagttgcgaaaattcaag
ctcaaaatccaaaaacaccttccagatacgcccaaatcatcacaaaccaatgaaaaaatg
tccagtttgaaaaaaaccaaggacgatcggaagaagagcattattcaagcagtttctgac
tttttccataagaagtcaccctcaccaccaaaaacgccctctagtcaaagcccaacaacc
cattttaatatcaatcttaggagagataagcagagcgatgcaccgccagtgcctccaccc
ccacagtcatacatgccgagtcaagaagatagcttttcggaagaggagacccattctggg
gacaacacatcactcataaagaagcaaaggatcagccgacgaattgcaaggcaggctcaa
agcaaaaggctacggatggcgcaggaagttcagaggcagttggaagaattggaagtaaaa
cagaaagagttggaagctcagggagttgctgtagaaaaggccctcaggggagaagaaacc
gcaggtgtgactgggagtgagagtgagcttttgggcgaatggctgcggctgacaagagaa
aggagcgaggcgaggagcaaagaaaaaatgctcgtcattcgtggtcaggaaatcgagctt
gaacacaggcacgctaggcttcaggcacagctgacatctctcatggatcaaaatcatgat
ggtaaaaaaacgagcgaggaggtggcactggaaggcaggattttgcgggagatgcttgaa
atagcagagaggaagaattcgcttcagcttcaactccaagcggagacacaaagattccaa
gaggaagatagggatttagaagcaaagatgaaagctaaaggcctccaactaccgctgaaa
caataa

DBGET integrated database retrieval system