KEGG   Cellulophaga lytica HI1: IX49_01740Help
Entry
IX49_01740        CDS       T03279                                 

Definition
(GenBank) molecular chaperone GroES
Organism
clh  Cellulophaga lytica HI1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C Pyr_redox AdoHcyase_NAD HI0933_like UDPG_MGDP_dh_N TrkA_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AIM59312
LinkDB All DBs
Position
375297..376313
Genome map
AA seq 338 aa AA seqDB search
MIATQYKGNKNFAVIDKKIEEPKDDEVRIKVAYSGVCGTDVHIYHGMMDKRVSIPQTIGH
EMSGIIDAVGKNVTNFKAGEKVVVRPLDDRKVKPSDKGFNHICEDLKFIGIDSPGSMQQY
WNVSAFVLHKLKPETDLKLAALIEPLSVATHDVRRSGLVKGETAVVLGGGPIGMLVAMVA
KEVGAQVIISEVNPTRIKMAKDLGFDAVNPTEVDLVAYVKSKTEDKRADVVFEVAGVQPA
LDIMCEVAGIRGRILMVAIHGDKKPVDLFKFFWKELSLIGARVYEKEDYEKSIELITENK
LPFEAMITDVQPLSKIQQVFENIDKNPSGMKVLMDCSL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatagcaacacaatataaaggcaataaaaattttgctgtaattgataaaaaaattgaa
gaacccaaagatgatgaggttcgtataaaagtagcctattctggcgtttgcggtacagat
gtacacatttatcatggtatgatggataaaagagtttctataccgcaaacaattggccat
gaaatgtctggtattattgatgctgtaggtaaaaatgtaaccaattttaaagcaggagaa
aaagttgtagtaagacctttagatgacagaaaagtaaaaccttctgataaagggtttaat
catatctgtgaggacttaaaatttattggtattgatagtcctggttctatgcaacagtac
tggaacgtatctgcgtttgttttacacaagctaaaaccagaaacagatttaaaattagct
gcgttaattgagccattgtctgtggcaacacatgatgtacgcagaagcggactagttaaa
ggtgaaactgctgttgttttaggtggcgggccaattggtatgttggttgctatggttgct
aaggaagttggcgcacaggttataatttctgaagtaaaccctacaagaattaaaatggca
aaagacctaggttttgacgctgttaacccaactgaggttgatttagtagcatacgttaaa
agtaaaacagaggacaaaagagcagatgttgtttttgaagtagctggcgtacaacctgct
ttagatattatgtgtgaggttgcaggtattagaggcagaattttaatggttgctattcat
ggagataaaaaacctgtagatctttttaagtttttttggaaagaattgagcttaattggt
gctagagtttatgaaaaagaagattatgaaaaatctatagagcttattacagaaaacaaa
cttccttttgaggctatgattacagatgtacagcctttaagcaaaattcagcaagtgttt
gaaaacattgataaaaacccttctggaatgaaagtattgatggattgcagtttataa

DBGET integrated database retrieval system