KEGG   Cellulophaga lytica HI1: IX49_01820Help
Entry
IX49_01820        CDS       T03279                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00052  Galactose metabolism
clh00511  Other glycan degradation
clh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    IX49_01820
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    IX49_01820
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    IX49_01820
Enzymes [BR:clh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     IX49_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 RVT_N Big_1
Motif
Other DBs
NCBI-ProteinID: AIM59328
LinkDB All DBs
Position
397161..399632
Genome map
AA seq 823 aa AA seqDB search
MQTYKLTALLLFLMFFSSCQEKEIEVLADQDFNRNWLFIKDSIPIAEAITIDDSNWRKVN
VPHDWAIEGPFSDKNNARNGGLPIDGIAWYRKHFTVDAKNKNKQISIEFDGVMDNSKVYI
NGNFVGERHYGYSGFEYDLTPFIKFGENNVIAVQLAPEILSERWYPGAGIYRKVRLKLNE
PIHIPQWGTYITTPKVASNKAVVSVETKLKNTLNTTENIVLETTILDINNTTVAVSSNKI
ELAKASEQKEVQKITVPNPILWDIGKPNLYTAVSRVIKDNKTIDEYTTEFGIRTIEFKKE
GFYLNGKAVELNGVCMHHDLGPLGAAVNYRATERQMQIMQQMGANALRTSHNPPSTEMLQ
VCDRLGIVVIDEAFDEWKEAKVPNGYHKYFDKWAEKDLRDMIKRDRNHPSVIMWSIGNEI
LEQGKKDGWKIAKMLNDICHNEDNTRPTTAGFNYYPASFKNKLAYQIDVVGVNYKPAYYA
EIREQNPDMIFYGSETSSQTSTRGYYEFPLKERVSKETNQVSSYDVNIGPSWTYPPEVEF
EAQKQNPHSLGEFIWTGFDYLGEPTPYGGRDNSTNGYWNDDWPSHASYFAPVDLVGFPKD
RFYLYQSQWTTEPMVHVLPHWNWEGKEGQNIPVYSYTNCDEVELFVNGKSYGKKIKGKDT
TTIFAEYNGFKGGTIDSKYRLSWNVPYQPGSLKVVGYKNGKPVATKEIKTASKPYKIKLI
ADRTTINASGEDLSFITVRVEDKDGNLCPKANHLINFKVSGNGNLEAVGNGNSASLESFQ
ANHITSFYGKSLAILKATENPGKITLTATADNLTSATITIKTK
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacatataaattaactgctttactactttttctgatgtttttttcttcttgccaa
gaaaaggaaatagaagttttagcagaccaagattttaatagaaactggttatttataaaa
gatagtattcctattgcagaagccataactattgatgatagcaattggagaaaagtaaac
gtaccacatgattgggctatagaaggtccgtttagtgataaaaataatgcacgtaacggt
ggtttacctatagacggtattgcctggtacagaaaacattttactgtagacgctaaaaac
aaaaacaaacaaatttctatagagtttgatggtgttatggataactccaaagtttatatt
aacggcaattttgtaggagaacgccattacggttacagtgggtttgagtacgatttaact
ccgtttataaaatttggagaaaacaatgttattgccgtacaattggctccagaaatttta
tctgaaagatggtatcctggcgctggtatttaccgcaaagttcgtttaaagttaaacgaa
ccaatacatattccgcaatggggaacatacattactacacctaaagtagctagtaataaa
gccgttgttagcgtagaaactaaactaaaaaataccctaaatacaactgaaaacattgta
ctagaaactaccattttagacataaacaatacaactgttgctgtttcaagcaacaaaata
gaactagctaaagcatctgaacaaaaagaggtgcaaaaaattacagtccctaaccctatt
ttatgggatattggcaaaccaaacttatacacagctgttagtcgtgttataaaagataac
aagacaatagatgagtacactacagaatttggtattagaactattgagtttaaaaaagaa
ggcttttacttaaacggaaaagcagtagaacttaatggtgtttgcatgcaccatgatctt
ggccctttgggtgctgctgtaaattatagagctacggaacgccaaatgcaaataatgcaa
caaatgggtgcaaatgctctacgtactagtcacaacccaccttctacagaaatgctgcag
gtttgtgatagacttggcattgtggttattgatgaagcttttgatgaatggaaagaggct
aaagtacctaatggttaccataaatattttgacaaatgggcagagaaagatttgcgagat
atgataaaaagagatcgcaaccacccatctgtaattatgtggagtattggaaacgaaatt
ttagaacaaggtaaaaaagatggctggaaaatagctaaaatgttaaatgacatttgtcat
aatgaagacaataccagacctacaactgctggttttaactattaccctgcttcatttaaa
aacaaattagcctaccaaatagatgttgttggtgtaaactacaaacctgcttattatgca
gaaattagagaacaaaaccctgatatgattttttatggatcagaaacatcttcacaaaca
agtactagaggttactatgagtttccattaaaagaaagagttagtaaagaaactaatcag
gtttctagttatgatgtaaatattggtccgtcatggacataccctccagaagtagaattt
gaagcacaaaaacaaaatccacattcgttgggagaatttatttggactggttttgattat
ttaggagaacctactccttatggcggaagagacaactctactaacggatattggaatgat
gattggccatcccacgcatcatattttgcacctgtagatttagtaggttttcctaaagac
aggttttatttgtaccaaagccaatggaccacagaaccaatggtacacgtattaccacat
tggaattgggaaggtaaagaaggccaaaacatacctgtatactcgtatacaaattgtgat
gaagtagaactttttgtaaacggtaaatcttatggcaaaaaaataaaaggaaaagatact
actaccatttttgcagaatacaatggttttaaaggtggcactattgactctaaatacaga
ctttcatggaatgtaccttaccaacctggaagcttaaaagttgttgggtataaaaatgga
aaacctgtagctactaaagaaattaaaacagcaagcaaaccttataaaataaaattaata
gcagacagaactactattaatgctagtggagaagatttatcatttattacagttagggtt
gaagataaagacggtaacttatgtcctaaagcaaatcatctaattaattttaaagtatct
ggtaatggtaatttagaagctgttggcaatggcaactctgcctcattagagtcttttcag
gcaaatcatattacatcgttttacggtaaaagtttagccattttaaaagctacagaaaat
cctggtaaaataactctaacagctactgcagataaccttacctctgctacaataactata
aaaactaaatag

DBGET integrated database retrieval system