KEGG   Cellulophaga lytica HI1: IX49_02730Help
Entry
IX49_02730        CDS       T03279                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00380  Tryptophan metabolism
clh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    IX49_02730
Enzymes [BR:clh01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     IX49_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIM59492
LinkDB All DBs
Position
complement(610791..612065)
Genome map
AA seq 424 aa AA seqDB search
MQFKNTLEFAKELDVNDALKGYRDQFYFPKINGKDAIYFTGNSLGLQPKTAQKFVDDVMQ
DWAQLGVEGHFYAEKSWWDYHERLAAPMATLLGAKTKEVCVMNTLTVNLHFLMASFYRPT
AKRFKIICEEKAFPSDQYMLTSQVKFHGFNPKDTIVEVKKREGEHFWRTEDVVAKINEVG
DELALVLIGGVNYYNGQVFDMKTITRAGKDVGAFVGWDLAHAAGNIELKLNEWNADFASW
CSYKYINSGPGNASGIYVNEKHLADDSIPRLEGWWGSKKETRFLMKPEFESSHTADSWQV
SNPPVLAMAPYLASLEMFAEVGMPALIKKRNVIVAYLEFVLQEIDKEVETANFEIITPKE
RGTQLSVLLHGQGKELFNYLMKNGVITDWREPNVIRLAPAPFYCSFEDMYRFGQILKEGI
LQSN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttaaaaatactttagagtttgccaaagaattagatgttaatgatgctttaaaa
ggatatagagatcagttttattttcctaaaattaatggtaaagatgctatttattttaca
ggaaattctcttgggttacagccaaaaacagcacaaaaatttgtagatgatgtaatgcaa
gattgggcacaacttggagtagaagggcatttttatgcagaaaaatcatggtgggattat
catgagcgtttagcagcgccaatggctacattgttaggagcaaaaactaaagaagtttgt
gtaatgaatacattaactgtaaatcttcattttttaatggcttcattttacagacctacc
gctaaaaggtttaaaattatttgcgaagaaaaagcatttccatcagaccaatatatgtta
accagtcaggttaaatttcacggttttaatcctaaagacactatagttgaggttaaaaaa
cgagaaggagaacatttttggcgtacagaagatgttgtggctaaaattaacgaagtagga
gatgagcttgcacttgtattaattggtggtgtaaactattacaacggtcaggtttttgat
atgaaaacgataacaagagcaggtaaagatgttggtgcttttgtaggttgggacttggca
cacgcagcaggtaatatagaacttaaattaaatgagtggaatgcagattttgcatcatgg
tgtagttataaatatataaatagtggcccgggtaatgcatctggtatttatgttaatgaa
aaacatttggcagatgatagcatacctaggctagaaggttggtggggatctaaaaaagaa
acacgttttttaatgaagccagaatttgagtctagccacactgcagactcttggcaagta
agtaatccaccagttttggcaatggctccttatttagcatctttagaaatgtttgcagaa
gttggtatgccagctttaattaaaaagagaaatgtaatagtagcttacttagagtttgtt
ttgcaagaaatagataaagaagtagaaacagccaattttgagattattacaccaaaagaa
agaggtacacaattgtctgtattgttacacgggcaaggaaaagagttgtttaattattta
atgaaaaacggagtaataacagattggagagagccaaacgtaatacgtttagctcctgca
ccattttactgttcttttgaagatatgtaccgttttggacaaattttaaaagagggtatt
ttacaaagtaattaa

DBGET integrated database retrieval system